KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0465Help
Entry
Pnec_0465         CDS       T00683                                 

Definition
(GenBank) polyhydroxyalkanoate depolymerase, intracellular
  KO
K05973  
poly(3-hydroxybutyrate) depolymerase [EC:3.1.1.75]
Organism
pne  Polynucleobacter necessarius subsp. necessarius
Pathway
Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pne00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Pnec_0465
Enzymes [BR:pne01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.75  poly(3-hydroxybutyrate) depolymerase
     Pnec_0465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(412500..413780)
Genome map
AA seq 426 aa AA seqDB search
MLYQLHEFQKALLQPVSSWARAASEAFINASNPASKVPGSDRLAASYELLYRLGKNYKKP
EFGIRSVMAHGKEVAIHERTAVAKPFCNLVRFKRFSDDVEVIKKLKEDPIVLIVAPLSGH
HSTLLHDTVRTLLQDHKVYITDWIDARLVPIEDGEFGLDDYVHYVQEFIRIIGAKDLHVI
SVCQPTVPTLGAISLMASADEATPASMIMMGGPIDARKSPTAVNNLADQKSYEWFESHVI
YNVPPNYPGAGRRVYPGFLQHTGFIAMNPQNHLQSHWDYFQNLVHGDEQDAEAHIRFYDE
YNAVLDLDSKFYLDTIKTVFQDYALPNGTWKVAGELVKPQDIKKTALLTVEGELDDISGS
GQTRSAHALCAGIPKENKDHYEVAGAGHYGIFAGRRWREKVYPKIKTFIREHQNTKKTAT
RTTKSA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgctatatcagttacacgaatttcaaaaagccctacttcaaccagttagttcatgggca
cgcgctgcgtctgaagcctttattaatgcttctaatcccgcttctaaagttccggggtct
gaccgtctagcagctagctatgagctcctttatcgcctaggtaaaaactacaagaaacca
gaatttggcattcgctcagtcatggcacatggcaaagaagtagccatccatgagagaact
gctgttgcaaagccattttgtaatttagtacgtttcaaacgcttctccgatgatgtcgaa
gtcattaagaaactcaaagaagatccaatcgtattaattgttgctccattatctggacat
cactccacattgttgcacgacactgtgcgcactctcttgcaagatcacaaggtttacatt
accgactggattgatgcacgcttagttcccattgaggatggcgagtttggtcttgatgac
tacgtgcactacgtacaagaattcatccgtattattggtgcaaaagatttgcacgtgatc
tctgtttgtcagccaacagttccaactttaggcgcaatctcgttaatggcatcagcagat
gaagcaactccagcttcgatgatcatgatgggcggtccaattgatgcacgcaaatcacca
actgcagtgaataacttggcggaccaaaaatcttatgagtggtttgaaagtcacgtgatt
tataacgtgccgcctaactacccaggtgccggtcgcagggtgtatccaggcttcttgcaa
catactggctttattgccatgaacccacaaaaccatttgcagtctcactgggactacttc
caaaacttggtacatggggatgagcaagatgcagaagcccatattcgcttctatgatgag
tacaacgctgtattggacctagactctaagttctacttagacaccatcaagactgttttt
caagactatgcattgcctaacggcacatggaaagttgccggtgaactcgtgaaaccacag
gatattaaaaagactgctcttctcaccgttgaaggtgagttggatgacatctctggaagt
ggccaaacacgttcagcccatgccttatgcgcaggcatcccaaaagagaacaaagatcac
tatgaagttgccggtgcaggtcactatggcatctttgctggtcgtcgctggcgcgaaaag
gtttatccaaagattaagacgttcattcgtgagcatcagaatacaaagaaaaccgctact
cggactaccaagtctgcataa

DBGET integrated database retrieval system