KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0467Help
Entry
Pnec_0467         CDS       T00683                                 

Definition
(GenBank) excinuclease ABC, B subunit
  KO
K03702  
excinuclease ABC subunit B
Organism
pne  Polynucleobacter necessarius subsp. necessarius
Pathway
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:pne00001]
 Genetic Information Processing
  Replication and repair
   03420 Nucleotide excision repair
    Pnec_0467
DNA repair and recombination proteins [BR:pne03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Pnec_0467
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      Pnec_0467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
415171..417327
Genome map
AA seq 718 aa AA seqDB search
MIAEMPSKLPKIGPNSEVKVDKKSPAADPLGEAGHDLDPAKFITFPDSLYQLYQPFAPAG
DQPQAIDALVEGIEDGLTFQTLLGVTGSGKTFTMANVIARTGRPAIIFAPNKTLAAQLYS
EFREFFPKNAVEYFVSYYDYYQPEAYVPQRDLFIEKDSSINEHIEQMRLSATKSLLERRD
VVIVATVSAIYGIGNPGDYHSMVMTLRPGDKMSQRDILMRLIAMQYDRNETDFKRGVFRV
RGDTIDIFPAEHNELAVRVELFDDVIESLQFFDPLTGKIRQKIPQFTVYPSSHYVTPRDT
VLKAIETIKTELRTRLDEFVKDGKLVEAQRLEQRTRFDLEMLNELGFCKGIENYSRHLSG
AAPGEAPPTLVDYLPNDAVMFLDESHVLIGQLNAMYNGDKSRKHTLVEFGFRLPSAMDNR
PLKFAEFETKMRQTIFVSATPADYEGTHQGQVVEQVARPTGLVDPEIEVLPASTQVDDLL
DQIHARVKVGERVLVTVLTKRMAEQLTDYLSDNGVKVRYVHSDIDTVERVEILRDLRLGV
FDVLVGINLLREGLDIPEVSLVAILDADKEGFLRSERSLIQTIGRAARNVRGKAILYADR
ITDSMKRAMGETERRRTKQIAFNKLHGIEPKGVQKRIKDIIDGVYDVKEKRQEMQIEQER
ARYEDMGEKDLVAEIKRLEKQMNAEAKNLEFEKAAGTRDRLTKVKEMAFGARSRDSIG
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgatagccgaaatgccctctaagttgcccaaaattggtccaaattctgaagtaaaagtg
gataagaaaagcccggcagcagatcctttgggcgaagctggccacgacttggatccagcc
aagtttattaccttcccggactccctttatcagctttaccagccgtttgcccctgctggg
gaccagccccaggctattgatgccttggtggagggtattgaggatggattgacctttcag
acgcttttaggggttactgggtcgggaaagaccttcacgatggccaatgtgatcgccaga
accggtcgtccagccatcatttttgcccctaataagaccttggcagcccaactttatagc
gaatttagggagtttttccccaaaaatgctgttgagtacttcgttagctactacgactat
tatcagccagaggcctacgttcctcagcgcgacctgtttattgagaaagattcctcgatt
aatgaacacatcgagcagatgcgcttatcggcaaccaagagtcttttagagcgtcgcgat
gtggttattgttgccaccgtttctgcaatttacggcattggtaatcctggcgactatcac
agtatggtgatgacattgcgtcctggtgacaagatgagccagcgtgatattttgatgcgt
ctcatagcaatgcaatatgaccgcaatgaaacggatttcaaacgtggcgtgtttagagtg
cgcggtgacacgattgatattttccctgctgagcataacgagctagcggtgcgagttgaa
ttgtttgatgatgttatagagagtttgcaattctttgatccgctcactggaaaaattcgt
cagaagatcccgcagtttacagtttacccaagttcacattacgtaacgccacgcgatacg
gttttgaaagcaattgaaaccatcaaaacagagttgcgtactcgcttagatgagtttgtt
aaagatggcaagttggtcgaagcacagcgtcttgagcaacgcacccgttttgatctagag
atgcttaatgaattaggtttctgcaaaggcattgaaaactactcgcgacacctatctggt
gccgctcctggagaggctccgcctacgttagtggactatctccctaatgatgctgtgatg
tttctcgatgagagtcacgtcttaattggacagctcaatgcgatgtataatggtgataaa
tcacgtaaacatactttggtagagtttggtttccgcttgccttcagcgatggacaatcgt
ccgctgaaatttgcggagtttgaaaccaagatgcgtcaaactatttttgtttctgcaaca
ccagcggattatgagggcacacatcaaggccaggtcgtagaacaagttgctagaccaact
ggattggtcgatccagaaattgaagttttgccagcaagtacacaagtggatgatttgtta
gatcaaattcatgcgcgtgtcaaagtgggtgaacgcgtattggtgactgtgttaaccaaa
cggatggccgagcaattaactgactatctttccgataacggggtgaaagtgcgctacgtg
cactctgatattgatactgttgaacgcgtagaaattttgcgcgacttgcgtttgggtgtc
ttcgatgttttagtcgggatcaacttattgcgtgaaggtctagatattcccgaggtttca
ctagtcgccattctggatgctgataaagagggtttcttgcgttctgagcgcagcctgatt
cagaccattggtcgtgcggcgcgaaatgttcgcggtaaggccattttgtatgccgatcga
atcacggactccatgaaacgcgccatgggggagactgaaagacgccgcaccaagcaaatt
gctttcaataagttgcatggtattgagcctaaaggggttcaaaagcgaattaaagacatt
attgatggtgtttacgacgtcaaagagaagcgtcaggagatgcagatagagcaggagcgg
gctcgctatgaggatatgggcgagaaagacttggtggctgaaattaagcgcctagagaag
caaatgaacgctgaagccaagaatctggagtttgagaaggctgccggcacacgagatagg
cttaccaaggttaaagaaatggcgtttggggccaggtccagagattcaatcggctaa

DBGET integrated database retrieval system