KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0470Help
Entry
Pnec_0470         CDS       T00683                                 

Definition
(GenBank) FeS cluster assembly scaffold IscU
  KO
K04488  
nitrogen fixation protein NifU and related proteins
Organism
pne  Polynucleobacter necessarius subsp. necessarius
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
419351..419737
Genome map
AA seq 128 aa AA seqDB search
MAYSEKVIDHYENPRNVGSFEKGDDSVGTGMVGAPACGDVMKLQIRVNDQGVIEDAKFKT
YGCGSAIASSSLVTEWVKGKTLDQAFEIKNSLIAEELALPPVKIHCSILAEDAIKAAVAD
YKEKHPAK
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggcatatagtgaaaaggtgattgaccactacgaaaacccccgtaacgttggttcattc
gaaaagggtgacgacagtgtgggtacaggcatggttggcgccccggcttgcggcgatgtc
atgaagctgcagattcgtgtgaacgatcaaggcgttattgaagatgcgaagttcaagact
tacggctgcggctctgcgattgcttcatcttcactggtaaccgagtgggttaaggggaaa
acattggatcaagcgttcgagattaaaaactcattgattgctgaagagttggctttgccg
ccagtaaaaattcactgctccatcttggctgaagatgccatcaaggcggcggtagcggat
tacaaagaaaaacatccagcaaaataa

DBGET integrated database retrieval system