KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0471Help
Entry
Pnec_0471         CDS       T00683                                 

Definition
(GenBank) iron-sulfur cluster assembly protein IscA
  KO
K13628  
iron-sulfur cluster assembly protein
Organism
pne  Polynucleobacter necessarius subsp. necessarius
Brite
Transfer RNA biogenesis [BR:pne03016]
 Prokaryotic Type
  tRNA modification factors
   Thiolation factors
    Pnec_0471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
419759..420082
Genome map
AA seq 107 aa AA seqDB search
MAITLTDKAAAHVNRNLEKRGKGCGLRLGVRTTGCSGLAYQLEYVDEPAAEDQVFESNGI
KVFVDPKSLAYLDGTELDFVREGLNEGFKFQNPNVKDECGCGESFRV
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atggcaattaccttaactgataaagcagccgcgcacgtaaaccgcaatttagaaaagcgc
ggcaaaggttgtggcttgcgtttgggcgttcgcactacaggctgttctggtttggcatat
cagctcgagtatgttgacgaaccagctgctgaagaccaggtatttgagtccaatggcatt
aaggtcttcgtagatccgaaaagcttggcttacttggacggtacagagttagattttgta
cgtgagggtttgaatgaaggatttaagtttcaaaatccaaacgtaaaggatgagtgtggt
tgtggcgaatccttccgcgtctga

DBGET integrated database retrieval system