KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0472Help
Entry
Pnec_0472         CDS       T00683                                 

Definition
(GenBank) co-chaperone Hsc20
  KO
K04082  
molecular chaperone HscB
Organism
pne  Polynucleobacter necessarius subsp. necessarius
Brite
Chaperones and folding catalysts [BR:pne03110]
 Heat shock proteins
  HSP40 / DNAJ
   Pnec_0472
Mitochondrial biogenesis [BR:pne03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    Pnec_0472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
420048..420587
Genome map
AA seq 179 aa AA seqDB search
MSVVVANPSASDDYFRFFGLSQQFKIDLPALDQTYLAIQKEVHPDRYARGSDSEQRLAMQ
MATLANTAFQTLKNPIQRGLYLCKLHGVDAKLETNTAMPAAFLMKQMEWRESLDDQAEDL
PALEVLMAEVEESKEDTLAEIAQAIDGAKNYERAAELLRGLLFIDKFAVELDDTIAALI
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtggttgtggcgaatccttccgcgtctgacgattactttcgcttctttggatta
agtcagcaattcaaaatcgatttgcctgctcttgatcagacatacctggcgattcagaag
gaagtgcaccctgatcgttatgctcgcggtagtgattcagaacagcgtcttgctatgcag
atggctaccttggcaaataccgcctttcagacccttaaaaatccaattcaacgcggcttg
tatttatgcaaactccatggcgttgatgctaaattagaaaccaatactgcgatgcctgct
gcttttctaatgaaacagatggagtggcgcgaaagcttggatgaccaggcggaggaccta
ccagcattagaagttttgatggctgaagttgaggaatccaaagaggacacccttgcagaa
attgctcaagctattgatggcgccaaaaattatgagcgcgcagcagagctgctgcgcggg
ttactctttattgataagtttgcggttgagcttgacgacaccattgctgccttaatctag

DBGET integrated database retrieval system