KEGG   Polynucleobacter necessarius: Pnec_0473Help
Entry
Pnec_0473         CDS       T00683                                 

Definition
(GenBank) Fe-S protein assembly chaperone HscA
  KO
K04044  molecular chaperone HscA
Organism
pne  Polynucleobacter necessarius
Brite
Chaperones and folding catalysts [BR:pne03110]
 Heat shock proteins
  HSP70 / DNAK
   Pnec_0473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DUF43
Motif
Other DBs
NCBI-ProteinID: ACB43740
UniProt: B1XTR3
Position
420616..422481
Genome map
AA seq 621 aa AA seqDB search
MALLQISEPGKSLAPHQRRIAVGIDLGTTNSLVAIVRDALPKVLPDAQGRELLPSVIRYL
PNGRTQAGFEALESVVIDPKNTIVSVKRFMGRGLLDVEHIESAPYDFVDQPGMLKLRTVA
GDKSPIEVSAEILARLRQLAEDSVSDEIVGAVITVPAYFDDAQRQATKDAAKLAGIEVLR
LLNEPTAAAITYGLDNASEGVYAVYDLGGGTFDISILRMSRGVFEVLATGGDSALGGDDF
DHRLYCWVIEQAKLPPLSIHDHRTLLQACKHAKEQLSHNPLARVHETLADGTVVNVGISQ
AQFFEITQNLVTKTLMTCKKALRDAGLKAEDVKGVVMVGGSTRMPNVQRAVAELFGTQPL
NNLNPDQVVALGAAMQADLLAGNQSKDDEWLLLDVIPLSLGIETMGGLVEKSIPRNTPIP
VARAQDFTTFKDGQTALAIQVVQGERELAQDCRSLGRFELRGIPAMAAGAARIRVTFQVD
ADGFLSVSATEQGSGVKASIDIKPSYGLTDAEITRMLQDGFASAKEDLLSRSLREEQVNA
QRLLDAVQTALDSDRSLLNAEEQAAIDREMTTLQKILNEETNSAVVRKAVDQAVKATDDF
AQKRMNASIQKALSGKNVTEI
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atggccttattacaaatctctgaacccggtaaatcgctagcgcctcatcagcgtcgcatt
gccgtaggcattgatttgggaactaccaattctttggtggcgattgtgcgtgatgccttg
ccaaaggtgctgccggatgctcaaggtcgtgagttactgccctccgtaattcgttattta
cccaatggtagaactcaagccggctttgaagcgcttgagagtgtggtgattgatccgaaa
aacacgattgtttctgtgaaacgcttcatgggccgtgggttgttggatgtcgagcacatt
gaaagcgctccctatgattttgttgatcagcctggaatgctcaagttgagaacagtggct
ggtgataaaagtccaatcgaagtttcggctgaaatcttggcgcgcttacgtcaacttgcg
gaagactctgtttccgatgaaatcgttggtgctgtgattacagttccagcttactttgat
gatgcgcagcgtcaagcgacaaaagatgcggcaaagttagcaggtatcgaagttctccgc
ctattgaatgaaccaactgccgctgcaattacttatggtttggataatgcttctgaaggt
gtttatgccgtctatgacttgggtggcggcacttttgatatctcaatattgcgtatgagt
agaggtgtatttgaggtgcttgccactggcggtgactcagccttaggtggcgatgacttt
gatcatcgtttgtattgctgggtaattgaacaagccaaactaccgccgctatcgattcat
gatcatcggactctcctacaggcttgcaagcatgctaaagagcagcttagtcacaatcct
ctagcacgtgtacatgagacccttgccgatggaacagtagttaatgtaggcattagccag
gcgcaattttttgagattacccagaatctcgttaccaagactttgatgacttgtaaaaaa
gcactacgtgatgccggcctcaaggctgaagatgttaaaggtgtggtgatggtgggggga
tcaacccgtatgcccaatgttcagcgagctgtagctgaactttttggtactcaaccattg
aataatttaaatcctgaccaagtggttgcgctcggcgctgcaatgcaagctgatttgctg
gcgggcaatcaaagtaaggatgatgagtggctcttgttggatgttattccactgtctctc
ggtattgaaactatgggtggtttagtggaaaaaagtattccccgtaatactccaatacca
gtcgctagagcacaggatttcacaacctttaaggatggtcagactgcattggctattcag
gtggtgcagggtgaacgtgagttggcgcaggattgtcgctcgctaggcaggtttgagtta
cgtggtattccagctatggcagcgggagcagcgcgtattcgagtgacttttcaagtggat
gctgacggatttctgtccgtaagcgcaactgagcagggttcgggggtaaaagcgtcgatt
gatatcaagccttcttatggtttaacggatgcggagattactcgcatgctgcaagacggt
tttgcatccgccaaagaagatctgctctctagatccttgcgtgaagagcaggtcaatgca
cagcgcttgctagatgcagtacaaacagcactagatagtgatcgcagtcttctcaatgca
gaagagcaggcggctattgatcgggaaatgactacattgcaaaagattttgaatgaagag
acaaacagtgcagtagtgcgtaaagcggtggatcaggcagttaaagctacagatgatttt
gcgcaaaaacgcatgaacgcaagtattcagaaggctttatccggcaagaatgttactgag
atctaa

DBGET integrated database retrieval system