KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0477Help
Entry
Pnec_0477         CDS       T00683                                 

Definition
(GenBank) Phosphoadenylyl-sulfate reductase (thioredoxin)
  KO
K00390  
phosphoadenosine phosphosulfate reductase [EC:1.8.4.8 1.8.4.10]
Organism
pne  Polynucleobacter necessarius subsp. necessarius
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pne00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Pnec_0477
Enzymes [BR:pne01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.8  phosphoadenylyl-sulfate reductase (thioredoxin)
     Pnec_0477
    1.8.4.10  adenylyl-sulfate reductase (thioredoxin)
     Pnec_0477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(424717..425295)
Genome map
AA seq 192 aa AA seqDB search
MVITDAINKAKAKIKLFTLATGRLHQETVDMIKTTEDRYGVSIEKIYPKEDNVQAFIYQY
GMNGFYDGEDPKKACCGARKIKPLNAALLGADAWITGQRREQSTTRTELNLEELDDARGI
AKFNPLFDWSEADIWAYIKQENVPIHPLHLKGYPSIGCEPCTRQVKKGEDIRASRWWWLQ
SDSKECGLHVNK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggtgattaccgatgcaattaacaaagcgaaagccaaaatcaagttatttactttagct
actggtcgccttcaccaagaaaccgtagacatgattaagacaactgaagatcgctatggc
gtgtcaattgaaaagatttatcccaaagaagataacgtacaagcctttatctatcaatat
ggcatgaatggcttttacgatggtgaagatcccaagaaggcatgctgtggcgcacgcaag
ataaaacctctgaatgcggcattacttggagcggacgcctggatcaccggccaacgacgc
gagcagtcaaccactcgtactgaactcaatttagaagagcttgatgatgctcgaggcatc
gcaaagttcaatcctttgtttgattggagtgaagcggatatttgggcctatatcaagcaa
gaaaacgttcctattcacccactgcacctaaagggctaccccagcattggttgcgaaccc
tgcacccgtcaagtgaagaaaggggaagatattcgcgcaagtcgatggtggtggctacaa
agcgacagcaaagaatgtggcttacacgttaataaataa

DBGET integrated database retrieval system