KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0484Help
Entry
Pnec_0484         CDS       T00683                                 

Definition
(GenBank) cysteine synthase A
  KO
K01738  
cysteine synthase A [EC:2.5.1.47]
Organism
pne  Polynucleobacter necessarius subsp. necessarius
Pathway
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pne00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Pnec_0484
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Pnec_0484
Enzymes [BR:pne01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     Pnec_0484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
428062..429036
Genome map
AA seq 324 aa AA seqDB search
MTYFTDNSQTIGKTPLVRLNRVTDGAKATVLAKIEGRNPAYSVKCRIGVAMINDAQEKGL
LGPGKEIVEPTGGNTGIALAFVAAARGIPLTLTMPETMSVERRKLLTALGAKIVLTEGPR
GMNDAVAKAKEIAESDSAKHVLLQQFSNPSNPAIHEKTTGPEIWEDTEGKIDVFVAGVGT
GGIISGVGRYIKNVQKKNIEVVAVEPTSSPVITQKLNGEEIKPAPHKIQGIGAGFIPDNL
DLSIVDKVEQISNEEAIEFARRIAKEEGILVGISYGAAAAVAVRLAKKPEYVGKTIVVAL
PDAAERYLSSALFEGVFDERGLPA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacttactttactgacaactcgcaaactattggtaaaacacctttagttcgtttaaat
cgcgtaactgatggtgctaaagcaactgtgctggcgaagattgagggtcgcaatccggcc
tattcggttaaatgtcgtattggtgttgcaatgattaatgatgctcaagaaaaaggtctt
ctaggtcctggtaaggaaatcgtggaacctactggcggcaataccggtatcgctttggct
tttgtagcggctgctcgcggtataccgctgacgcttaccatgccggagactatgagtgtt
gagcgtcgcaagttgcttactgcattaggtgccaagattgtcttgactgagggtcctagg
ggtatgaatgacgctgttgctaaagccaaagaaattgctgagtctgattctgctaaacat
gtgttactccaacaatttagcaacccatctaatcctgcaatccatgaaaaaactactggc
ccagaaatctgggaagacaccgaaggcaagatcgatgtatttgttgctggcgtaggaact
ggtggaataatctctggtgttggacgttacattaagaatgttcagaaaaagaatattgaa
gtggttgcggttgaaccaactagtagtcctgtaattacccagaagctaaatggcgaagag
atcaagccggctccacataagattcaaggtattggcgctggatttattccggataatttg
gatttatcgatagttgataaggtggagcagatttccaatgaagaggctatcgagtttgcc
cgccgtatcgccaaggaggaaggtattttggtgggtatttcctatggtgcggctgcggct
gtagcggtgcgccttgccaagaagcctgaatatgttggcaaaactatcgtggtagctctg
ccggatgccgctgagcgttacttaagctctgccttattcgaaggcgtgtttgatgagaga
ggcttgccagcttaa

DBGET integrated database retrieval system