KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0489Help
Entry
Pnec_0489         CDS       T00683                                 

Definition
(GenBank) lipoprotein releasing system, transmembrane protein, LolC/E family
  KO
K09808  
lipoprotein-releasing system permease protein
Organism
pne  Polynucleobacter necessarius subsp. necessarius
Pathway
ABC transporters
Module
Lipoprotein-releasing system
Brite
KEGG Orthology (KO) [BR:pne00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Pnec_0489
Transporters [BR:pne02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Lipoprotein-releasing transporter [MD:M00255] [OT]
    Pnec_0489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
434592..435854
Genome map
AA seq 420 aa AA seqDB search
MLRLPIELEIGLRYTRSKRRKTVGKRDGFLSFISGISTAGIALGVASLIVVISVMNGFQK
EVRDRMLSVLSHVEITAPDGLANWEPLALKVAAQPHVVGVAPMVSSQGLLSRESMMRGVA
IRGILPSEESKVSDLPKQFVAGSIDDLKPGSFGVALGAQLAAIVGAHLGDRINLIVPESD
LTPAGAMPRMRILQVVGIVDSGHYEYDSSLAIMHWKDAAALLRLHDPSGLRVKVDDMQRA
PQVANELAAIVPQALWVIDWSKSNRNWFAAVQTEKKMMFIILTLIIAVAAFNLVSTLVMT
VNEKQADIAILRTMGASPGLIQRIFLIQGLSIGLLGSLAGVGLGLLIALNIDAIVPVIEV
IFRVQFLPHEVYFISELPSDVRASDVLTVGLMAFGLSVLATLYPSRRAAKVQPAEALRYE
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgttgagacttcctattgagctagaaattggcctgcgctacacccgatctaagcgtcgc
aagacggtagggaagcgtgacggcttcctgtcctttatctcaggaatatctaccgctggt
atcgctttgggggttgcatcgctgatcgtagttatttcggtgatgaatggctttcagaaa
gaagtacgggatcgcatgttgtcggttttatctcatgtggagattaccgcgcctgatggg
ttggcaaattgggaacctctggcgcttaaagtggcagcacaacctcatgtagttggtgtg
gcacctatggtgagctcgcaaggattgcttagtcgtgagagtatgatgcgtggtgtagcg
attcgtggcatcttgccaagtgaagaaagtaaggtgtctgatttaccaaaacaatttgtt
gcgggcagcattgatgatttaaagccgggaagttttggggttgccttgggcgcacaactt
gcagcgattgttggtgcgcacttgggcgatcgtattaatttgattgttcctgaaagtgat
ttaacgccagcaggcgctatgcctcgtatgcgcatacttcaagtagtgggtattgtggat
agtggacattatgaatacgacagctccttagctatcatgcactggaaagacgctgccgcc
ttgttgcgcctccatgacccatctggcttacgtgtcaaagtagatgatatgcagcgcgcc
ccgcaagtcgccaatgaattggcggctattgtgcctcaagctctctgggttatcgactgg
tcaaaatcgaatcgcaactggtttgctgcagttcagaccgaaaagaaaatgatgttcatc
atcctaacgttgattattgcagtagcagcttttaatttggtatccaccttagtgatgact
gtgaatgagaaacaggctgatattgcaattttaagaacgatgggtgcaagccctggctta
atccagagaatatttttaattcaaggtttatcgattggtcttttgggatctttagctgga
gtaggcttaggcttactaattgcactcaatattgatgccattgttccagtgattgaagta
atcttccgtgtacagtttttgccgcatgaagtgtatttcatcagtgagctaccttccgat
gttagagcaagtgatgtgcttacagttggcttgatggcctttggtctatctgtactggcg
acactgtatccaagtcgtcgagccgctaaggttcaacctgcagaggctctacgttatgaa
taa

DBGET integrated database retrieval system