KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0490Help
Entry
Pnec_0490         CDS       T00683                                 

Definition
(GenBank) ABC transporter related
  KO
K09810  
lipoprotein-releasing system ATP-binding protein [EC:3.6.3.-]
Organism
pne  Polynucleobacter necessarius subsp. necessarius
Pathway
ABC transporters
Module
Lipoprotein-releasing system
Brite
KEGG Orthology (KO) [BR:pne00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Pnec_0490
Enzymes [BR:pne01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     Pnec_0490
Transporters [BR:pne02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Lipoprotein-releasing transporter [MD:M00255] [OT]
    Pnec_0490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
435847..436572
Genome map
AA seq 241 aa AA seqDB search
MNNLVLKARDLAKTYGQGPTAVEVLKAIDLDVAPSEKLAIVGSSGSGKSTLLHLLGGLDT
PSSGSVILVGSILNNLSVRKLDQLRNHSLGFIYQFHHLLDEFSAAENVALPLRIRGLSND
ESMDRASKMLKAVGLSARELHTPGELSGGERQRVAVARALVGNPTCVLADEPTGNLDTET
ADGVFDLMLNIARDQGTAFVIVTHDPVRAKRCDRILHLERGVLKTFSACVDIPCGSIPIA
I
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaataacttagtgctcaaagccagagaccttgcaaaaacgtatggtcagggtcctaca
gcggttgaggttctcaaagcaattgatttggatgtggcgccctcagaaaagcttgctatt
gttggctcttcaggttctggcaaaagcactttgctgcacctcttgggcggtttagatact
ccaagttctggttcggtaattttggtcggctctattttgaataacttatcagtgaggaaa
ttagatcagctacgcaatcatagtttgggtttcatttaccagttccatcacctcttagat
gaatttagcgctgccgagaatgttgcgctaccgctgcgtattcgtggtttaagtaatgat
gagtctatggatcgcgccagtaagatgctgaaagcggttgggctatcagctcgagagcta
catactcctggcgagctgtcgggcggagagcgtcaacgtgttgctgttgctcgtgccttg
gtcggtaatcccacttgcgttttggcggatgagccaaccggtaatcttgatactgagact
gctgatggcgtatttgatttgatgttaaatattgctcgcgatcaaggtactgcgtttgtg
attgtgactcatgatcctgtgcgcgctaaacgttgtgatcgcattttgcatttagagcgt
ggagtattgaaaacattttcagcgtgtgtggacatcccatgtggatcgatacccattgcc
atctag

DBGET integrated database retrieval system