KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0493Help
Entry
Pnec_0493         CDS       T00683                                 

Definition
(GenBank) DNA internalization-related competence protein ComEC/Rec2
  KO
K02238  
competence protein ComEC
Organism
pne  Polynucleobacter necessarius subsp. necessarius
Brite
Secretion system [BR:pne02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components [MD:M00429]
   Pnec_0493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
438851..439660
Genome map
AA seq 269 aa AA seqDB search
MLVSGVGIVYAIRPGEIADTWMRRLLGIVFSIPLFIAPFQYLRGRGISYIDRMAISHSDS
DHIGGAATLLKHIQFDSMMGSLPSKNPLLENLQQRGIPSIPCRYGQRWIWDGIEFVIWHP
HETTVFSNQHSGKPNEMSCVLEVRNTQSSLWLTGDVEKQGETKISERLSRKMLEEIGDRE
LVFMVPHHGSKTSSSLGLLKQLDPDQAFAQNGYRNRYGHPHPDVTARYKDLNIPFYQTPQ
TGFQSWVFKNNAKSSTQFWRHDIKRLWHR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgctggtctcaggagtagggattgtttatgcgatccgtccaggcgagattgcggacaca
tggatgcgaagattgctgggcattgttttttctattcctctatttattgcgccattccag
tatttgcgtggaaggggaattagctatattgatcgtatggcgattagtcatagtgatagc
gatcatataggtggcgcagcaacgctgctaaagcatattcagtttgattctatgatgggg
tctttgcctagcaagaatcccttgctagaaaatttgcagcagagagggatacccagcatc
ccctgtcgctatggtcagcgctggatatgggatggtattgaattcgttatctggcatccc
catgaaacaacagtattttccaatcagcattctggaaaacccaatgagatgagttgtgtg
ctggaagtgcgcaatacgcaaagctctctttggttaacaggcgatgttgaaaagcaaggc
gagacaaaaatttccgagagattaagtagaaaaatgctggaagaaattggcgatagagag
ttggttttcatggtgccgcatcatggcagcaaaacatcttcatctttggggcttctgaaa
cagttggatcctgatcaggcttttgctcaaaacggctatcgcaatcgatatggacatccc
catcctgatgtgacagcgcgctacaaagatttaaatattcctttttatcaaactccgcaa
acaggttttcagtcttgggtatttaaaaataatgccaagtcttcgacacaattttggagg
catgatataaaacgactatggcatcgctag

DBGET integrated database retrieval system