KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0494Help
Entry
Pnec_0494         CDS       T00683                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pne  Polynucleobacter necessarius subsp. necessarius
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
439688..440059
Genome map
AA seq 123 aa AA seqDB search
MNKLLVLSSIVVAIAVGCAGANVRPLVDMKSVNESAYEKDLSECQAYAQQQSGMGEKAAK
GAGAGAVVGGLLGLVTGGNKTGIVQAAGAGAVIGAAGGAFTGDQAQEAVVKRCLSGRGYK
VLN
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgaataagctactcgtcttatcttctatagttgttgctatagcggttggctgtgccggc
gcgaatgttcgtcccctcgtggatatgaagagtgtaaatgaaagtgcatatgaaaaagat
ctaagtgaatgtcaggcttatgcgcaacagcaatcaggtatgggtgaaaaagctgcaaaa
ggagctggtgctggcgcagttgttggtggcttattgggtcttgttactggcggcaataaa
accggcattgttcaggctgccggagcgggagctgttataggtgctgcgggaggtgctttt
acaggcgaccaggcgcaagaggcggttgttaagagatgtttgagtggacgcggttacaag
gtactgaactaa

DBGET integrated database retrieval system