KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0497Help
Entry
Pnec_0497         CDS       T00683                                 

Definition
(GenBank) DNA repair protein RadA
  KO
K04485  
DNA repair protein RadA/Sms
Organism
pne  Polynucleobacter necessarius subsp. necessarius
Brite
DNA repair and recombination proteins [BR:pne03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Pnec_0497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
442974..444242
Genome map
AA seq 422 aa AA seqDB search
MEEGLLETTSNSRFQGLAQSLPRQKLSAIAAEDLPRFSTGVEEFDRVLGGGLVPGGAVLL
GGDPGIGKSTLLLQALAEMSAAGMNVLYSSGEESAAQIALRAKRIALDAPQLEVLAEIRL
EKLISIMDTVKPQVLVVDSIQTLYSEVLSSAPGSVAQVRECAAQLTRAAKSSGICVLMVG
HVTKDGHLAGPRVLEHIVDTVLYFEGDTHSSFRLVRSIKNRFGAVNELGVFAMTEKGLRG
VTNPSAIFLSQHEQMVPGACVLVTQEGSRPLLVEIQALVDTAHVPNPRRLAVGLEQARLA
MLLAVLHRHAGVACFDQDVFLNAVGGVKISEPAADLAILLAIQSSIRNRALPKELIVFGE
VGLAGEIRPCPRGQERLKEAVKLGFTLAIIPKANMPKTKIPGVKVIPVERIDQAIAAAAE
LS
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaggtcttctggaaacaacttccaattctcgttttcagggtttggcgcaatcg
ttgccaagacaaaagctctctgctattgctgcggaagatttaccaaggtttagtacgggt
gtagaggagtttgatcgcgtgctgggtggtggcttagttccgggcggagcagtgctctta
ggtggtgaccccggtattggtaaatcaactttgctattgcaagcacttgcagagatgagt
gctgccgggatgaatgtgctttatagcagcggcgaagaatcggctgcccagattgcattg
cgtgcgaagcgcattgcattagatgccccccaactagaagtgttggctgaaattcggtta
gagaaactgatttcaattatggacaccgttaagccacaagtattagtggtggattccatt
cagaccttgtattcagaggttttaagttcagccccaggctctgttgctcaagtacgcgag
tgcgctgcgcaattaacgagagctgctaaatcaagtggcatctgcgtgctgatggtaggg
catgtgaccaaggatggtcatctggctggtcctagagtgttagagcatattgttgatacc
gttttgtatttcgaaggcgatacccattcttctttccgcttagtgcgatccatcaagaat
cgctttggcgctgtcaatgagcttggtgtattcgctatgacagaaaaaggtttgcgggga
gtaaccaacccttcggcgattttcttgtcgcaacacgaacaaatggttcctggtgcctgt
gtattggttacgcaagaaggcagcagacctttgttggtggagattcaggctctggtggat
accgcgcatgtgcccaatcctcgccgcttagcagttggcttggaacaagctcgtttggca
atgctcttggcggtgttgcatcgtcacgctggtgttgcctgttttgatcaagatgttttc
ttaaatgcagttggtggcgtaaagatatccgagccggctgctgacttagctatattgctc
gccattcaatcttctattcggaatcgcgccttgcctaaagagttaatcgtatttggtgaa
gttggtttggctggagagattcgtccttgtccacgcggtcaggagcgcttgaaagaagct
gttaaattgggctttactctagccatcattccaaaagccaatatgcctaagactaagatt
ccaggggtgaaggtaattccagtggagcgaattgatcaggcaatcgcggcggctgcagag
ttaagttaa

DBGET integrated database retrieval system