KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0501Help
Entry
Pnec_0501         CDS       T00683                                 

Definition
(GenBank) chromosome segregation protein SMC
  KO
K03529  
chromosome segregation protein
Organism
pne  Polynucleobacter necessarius subsp. necessarius
Brite
Chromosome [BR:pne03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Condensin-like complex
    Pnec_0501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
447427..450885
Genome map
AA seq 1152 aa AA seqDB search
MPGQLIGVVGPNGCGKSNIIDAVRWVLGESRASELRGESMQDVIFNGSGLRKPSGRASVE
LIFDNTEGRAQGQWSAFTELGIKRVLTRDGNSSYYVNNQVVRRKDIQDIFLGTGMGPRGY
AIIGQGTINRILEAKPEELRVFLEEAAGVSKYKERRKETASRLENTVENLTRVEDILREL
DQQLTRLEKQATVAERHAELSTQMKSQQQLLWFVRQTEAGKEQERHANGIRDTQVGLEEQ
TAKLRHIEAELETMRTQQYALQDKVSQAQGDLYQTNSDVSQVESQILYVQEARQRLQQQT
QDLQAQLQRWTVQETDAAQAQRTTEHELSLAAEKKQTLLADLNGLQEQMPSREEAYQNAN
RELNQARDSLASIEQRLASLGERIRSMSAQSDELKGCETRLVGEFDGLRRPDAEALQMAI
DRQTIAARKVEEAKHRAVETQQRVPASDEARNAAQQKIQVANQDLAQTEAKLTALTALQA
SVQAQGKIGPWLESKGLKESKRLWQELKVESGWEAALESVLRERLAAVTAKSVQETLALA
NDAPPSRLAILLTEEITPAHTSAPADFTPLLSRVQSAGAPRLTSVLQEWLDNIYIASSLE
DALHRREKLPAGGAFVTQQGHLVSRVGVQLYAADSEQAGMLARAQEMESLEKQLRAQQLM
QSELKGELDQCVAKYQAAHQAAEQARENAEHAVQEAHGFEVERMQLTQAEEQYSQRAAQI
QGELSELRQQMEQLAQTQEQSATELLESEESKRGLQEALQVAQEKLERSTEERDRLRESL
RAAEMAAQEAAFATRSLQQRIADLQRDQSTARTQIMEIQNKHDSATQELETLSDEEAQDK
LQGLLLARSAREAALANARTEQDALLHQLREADESRMQVERGLQPMRDKVVDLQLREQAA
RLNFEQFATLLSDAEADLTALEASFSPDLKVGALQSEVNRLNTEIQALGPVNMAALDELS
SSRERKQFLDAQSADLNEAMQTLTDAIARIDAETRDLLQGTFDQVNAHLGKLFPELFGGG
HAELVMTGEEILDSGVQVMAQPPGKKNSSIYLLSGGEKALTAIALVFSLFLLNLTPFCLL
DEVDAPLDDANTLRYAQLVAKMSDKTQFLFISHNKITMEIAHQLIGVTMQEQGVSRIVAV
DISSAVSMVETA
NT seq 3459 nt NT seq  +upstreamnt  +downstreamnt
atgcctggccaattaattggcgttgtgggccctaatggttgcggaaagtcgaacattatt
gacgctgtccgctgggttttgggcgagtctcgcgctagtgaattgcgtggcgaatccatg
caggacgttatttttaatggttctggtttacgcaaaccatctggccgtgccagcgtagaa
ctcatttttgataacactgagggacgcgctcaaggtcagtggagtgcttttacagaattg
ggtattaaacgtgttctgacgcgtgatggaaattcaagttattatgtcaataatcaagta
gtacgccgcaaagatattcaagatattttcttgggtaccggaatgggcccaagaggttac
gcgattatcggtcaaggaacaattaaccgtattttggaagcgaagcctgaagagttgcgc
gtgtttttggaagaggcggccggagtttctaaatacaaagagcgtcgtaaagaaacagca
tcacgcttagaaaacaccgtagaaaacctaactcgcgtagaagatatcttgcgtgaactt
gatcaacagttaactcgtttagagaaacaagctactgttgccgagcgccatgcagagctt
tctacgcagatgaaatctcagcaacagttgctgtggtttgtgcgtcagaccgaggctggt
aaggagcaggagcgtcatgccaacggtattcgtgacacgcaagttggtttagaagaacag
actgctaagctacgtcacattgaagctgagctagagacaatgcgcacacaacagtacgca
ttacaagataaagtttctcaagcgcaaggcgatttatatcaaacaaattctgatgtgagt
caggttgagtcacagattctttatgtgcaagaagcacgtcaacgcttgcaacagcaaact
caagatttgcaggcgcaattacaacgttggactgtgcaagagactgatgcagcacaagcg
caacgcactactgagcatgagctttcattggctgctgaaaaaaaacagaccctcttagcg
gatttgaatggcttgcaagagcaaatgccaagtcgtgaagaggcttatcaaaatgcaaat
cgtgaactcaatcaggcgcgagactctcttgcatccattgagcaacgcttagcgagtttg
ggtgagcgtatccgctctatgtcggcccagtccgatgaattgaaggggtgtgaaactcgt
ctcgttggtgaattcgatggtttgcgtcgtccggatgccgaagctttgcagatggcgatt
gatcgccagacaatagctgctcgtaaggtggaagaggccaaacatcgcgctgtcgaaact
caacaacgtgttcctgcttctgatgaagcgcgcaatgcggcccaacaaaaaattcaggta
gcaaatcaggatttagctcagaccgaagctaaattgactgctttgactgctttgcaggcc
agcgttcaagcgcaaggcaagattgggccttggctagaaagtaagggccttaaagagagc
aagcgtctttggcaagagcttaaggtagagagtggttgggaagcggctctcgagtcagta
ttgcgtgagcgcttggctgcggttaccgcaaagagtgtgcaagaaacactggccttggct
aatgatgcgcctccaagtcgtttggcaattttactcaccgaagaaattactccggcgcat
acctctgctcctgctgacttcaccccattattaagccgcgttcaaagtgctggtgcacca
agactcacttcagttttgcaagagtggttggacaatatctatatcgctagcagtctcgag
gatgcattacatcgtcgtgaaaaattgcctgctggtggtgcatttgttactcaacaaggt
catttggttagtcgtgttggggtgcagctttacgcagcagactctgagcaagccggtatg
ttggcacgtgctcaagagatggaaagtctagagaagcaattgcgcgcacagcaactgatg
caaagcgagcttaagggcgagctggatcaatgtgtagcgaagtaccaagcagctcatcag
gcggctgaacaagcacgtgaaaatgcagagcatgccgttcaagaggctcatggttttgaa
gtagaaagaatgcagttgacccaagctgaagagcaatacagtcaacgtgctgcccaaatt
cagggtgagttaagcgagttgcgtcaacaaatggagcaattggcccaaactcaagaacag
tctgctactgagttgcttgaatccgaagaatctaaacggggcttacaagaagccttacaa
gtggcacaagaaaagttagagcgttctactgaagagcgtgatcgtttgcgcgagtcactg
cgtgctgctgagatggctgcgcaagaagctgcttttgctactcgttctttacagcaacgt
attgcagacttacaacgtgatcaaagtactgcgcgtactcagatcatggagatccagaat
aaacatgactcagccactcaagagctggaaactttgagtgatgaagaggcgcaagataaa
ttgcaaggattattattggctcgcagtgcgcgtgaggctgctttagcaaacgctcgtact
gagcaagatgccttattgcatcaattgcgcgaagccgatgagtctcgcatgcaagttgag
cgcggtttgcagccgatgcgcgataaggtggttgatttgcaattgcgtgaacaagctgct
cgtttgaactttgagcaatttgctaccttattatctgatgctgaggctgacttaacagcg
cttgaagcaagtttcagtcctgacttaaaggttggcgcattacaaagcgaagtaaatcgc
ttgaataccgagattcaagctttgggcccagtcaatatggctgccttggatgaattgtct
agttcacgtgagcgtaagcagttcttggatgctcaatctgccgacttaaatgaagcaatg
cagactttgaccgatgcgatcgccaggattgatgctgaaacacgcgatctcttgcagggt
accttcgaccaggtgaatgcccaccttggcaaacttttccccgagctgtttggtggtggt
catgctgaattggtgatgactggcgaagagattttagattctggtgtccaggtgatggct
cagccaccgggcaagaaaaacagctctatttatctcctctcaggcggtgagaaagctttg
actgcgattgctttggtgttctcgctcttcctcttgaacctgaccccattctgtttgcta
gatgaggttgatgcgccattggatgatgcaaataccttgcgctatgcacagctagttgcc
aaaatgtcagataagacacagtttttatttatctcacataacaagatcactatggaaatt
gctcatcaattgattggtgtcacaatgcaagagcagggcgtctcccgtattgttgcggtg
gatatctcctctgcggtatcaatggtagagactgcctaa

DBGET integrated database retrieval system