KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0504Help
Entry
Pnec_0504         CDS       T00683                                 

Definition
(GenBank) NUDIX hydrolase
Organism
pne  Polynucleobacter necessarius subsp. necessarius
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
454051..454542
Genome map
AA seq 163 aa AA seqDB search
MNALAAIATQAKNSPYSDQCKLVLASADPYARASKAGHITASGLVIRDDKVLLIFHPFIK
RWFQPGGHIDEGESSIEAAIREVYEETGYVCELDSNNQEPIDIDIHETPENPKKGEGAHL
HIDLLYCLRVVRQEQSEEDIECKWFAFNEIESIRIQRALAKLA
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcacttgcagcaattgctactcaggcaaaaaattctccatattcagatcaatgc
aaattggtattggcatctgcagatccttatgcacgcgcatctaaagcggggcacatcacc
gcgagtggcttagttattcgtgacgataaggttttgcttatattccatccttttataaag
cgctggttccagccaggcggccatattgacgaaggtgaatcttcgattgaggctgcaatt
agagaggtttatgaagaaaccggctacgtctgtgagctggactccaataaccaagagccg
attgatattgatattcacgagacccccgaaaatcccaaaaagggcgagggcgctcattta
cacattgatttactttattgcttgcgagtcgtgcgacaagaacaatcggaggaagatatt
gaatgtaaatggtttgctttcaatgaaatcgaaagcattcgaatccagcgcgccttggct
aaactcgcttaa

DBGET integrated database retrieval system