KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0507Help
Entry
Pnec_0507         CDS       T00683                                 

Definition
(GenBank) ribosomal protein S2
  KO
K02967  
small subunit ribosomal protein S2
Organism
pne  Polynucleobacter necessarius subsp. necessarius
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:pne00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    Pnec_0507
Ribosome [BR:pne03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    Pnec_0507
  Bacteria
    Pnec_0507
  Archaea
    Pnec_0507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
458202..458951
Genome map
AA seq 249 aa AA seqDB search
MSVTMRQMLEAGCHFGHQTRFWSPKMAPFIFGHRNKIHIINLEKTLPMFQDALKFTKQVA
ANRGTILFVGTKRQSREIIAEEAARAGMPYIDSRWLGGTLTNFKTVKGSLKRLKDMEVAK
EAGDWEKLSRKEALTNDRDLDKLQKALGGIKDLNGIPDAIFVVDVGYHKIAITEANKLGI
PVIAVVDTNHSPEGVDYIIPGNDDSSKAVILYAHGIANAILEGKANSVQEILTAVKEGEE
EFVEEGKVE
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtaactatgcgtcaaatgctggaagccggttgccattttggtcaccaaactcgc
ttctggtcaccaaagatggccccatttattttcggtcatcgcaacaaaatccacatcatc
aacttggaaaaaacattgccaatgtttcaggacgccctgaaatttacaaaacaagttgct
gctaatcgtggcacgattttatttgttggtactaagcgtcaatcacgcgagatcattgct
gaagaagctgctcgtgctggtatgccttacatcgacagccgttggttgggcggtacgctc
accaacttcaaaactgttaaaggttccctcaagcgtttgaaagatatggaagttgccaaa
gaagctggcgactgggaaaagctttctaggaaagaggctttgactaatgaccgtgatctc
gacaaattgcaaaaagcgcttggcggtattaaagatttgaatggcattcctgatgcgatt
tttgtagtagacgttggctatcacaagattgctatcactgaagctaataaattaggtatt
ccagttatcgctgttgtagatactaaccactcaccagaaggcgttgattacatcatccct
ggtaacgatgactcaagcaaagcagtaattctctatgcgcacggcattgctaacgcaatc
ctcgaaggtaaggctaactctgtacaagaaattttgacagcagttaaagagggtgaagaa
gagtttgttgaagaagggaaagttgaataa

DBGET integrated database retrieval system