KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0516Help
Entry
Pnec_0516         CDS       T00683                                 

Definition
(GenBank) outer membrane chaperone Skp (OmpH)
  KO
K06142  
outer membrane protein
Organism
pne  Polynucleobacter necessarius subsp. necessarius
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
467635..468162
Genome map
AA seq 175 aa AA seqDB search
MKLYQSSKWIQAGLFAAVTALVAPQVFAQDAGTRVAVVNSEKVFNESNLAKAMQTRLQNE
FTKRQNDLRDSAQRIKSAAEKLDRDAAVMNEAERIRRQRELADQDRELQRKQREFTEDLN
QRTFEERAKIAEKANAVLKQIAEQRKIDVIVQEAAYVSPKADVTDDVIKTLNSLK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttatcaatcttccaaatggatacaagcgggcctatttgctgcagtgacggct
ttagtcgccccacaggtttttgctcaagatgcgggcacccgtgttgcggttgtgaactct
gagaaagtatttaatgagtccaatcttgcaaaagcaatgcaaacccgtttgcaaaatgaa
tttacgaagcgtcaaaatgatttgcgcgatagcgcgcaaagaattaagtctgcggcagaa
aagcttgatcgtgacgcagccgttatgaatgaagctgagcgtattcgtcgtcaacgtgag
ttggctgaccaagatcgcgaattacaacgtaagcaacgtgagttcactgaagatctaaat
cagcgtacttttgaagaacgtgccaagatcgcagaaaaagcaaacgcagtgttaaagcaa
attgctgaacagagaaaaattgatgtcattgttcaagaagcagcttatgtcagcccaaaa
gccgatgtaactgatgatgtcatcaaaaccttgaatagtcttaagtaa

DBGET integrated database retrieval system