KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0518Help
Entry
Pnec_0518         CDS       T00683                                 

Definition
(GenBank) beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
  KO
K02372  
3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
pne  Polynucleobacter necessarius subsp. necessarius
Pathway
Fatty acid biosynthesis
Biotin metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pne00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Pnec_0518
  Lipid metabolism
   00061 Fatty acid biosynthesis
    Pnec_0518
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Pnec_0518
Enzymes [BR:pne01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     Pnec_0518
Lipid biosynthesis proteins [BR:pne01004]
 Fatty acid synthase
  Component type
   Pnec_0518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
469282..469731
Genome map
AA seq 149 aa AA seqDB search
MSTPIAIDINKILKLLPHRYPFLLVDRVLEISPRESITALKNVTMNEPFFQGHFPGFPMM
PGVLIIEALAQTAALLTFSDERAEDAIYYFAGIDGARFKKPVLPGDQLIMTAKLERDRAG
IYKFAVQATADGEIAAEANITCAVRTKGA
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgagtacaccaatcgcaatcgacattaataagattcttaaattgttaccgcatcgctac
ccatttttgttggtagatcgtgtattggaaatctctccgcgtgaaagtattaccgcatta
aagaatgtcactatgaatgagccattttttcagggccattttcctggcttcccaatgatg
cccggagtgctcatcattgaagccctagcacaaacagctgctttattaactttctcagat
gagcgtgcagaggatgcgatttactacttcgcaggtattgatggtgctcgttttaaaaag
ccggtgctacctggtgaccagttgatcatgactgcgaagttagagcgcgaccgtgcgggt
atatataagtttgcggttcaggcaactgctgatggtgaaattgctgcagaagcgaatatc
acctgtgcggttcgtacgaaaggcgcgtaa

DBGET integrated database retrieval system