KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0526Help
Entry
Pnec_0526         CDS       T00683                                 

Definition
(GenBank) SsrA-binding protein
  KO
K03664  
SsrA-binding protein
Organism
pne  Polynucleobacter necessarius subsp. necessarius
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(474136..474588)
Genome map
AA seq 150 aa AA seqDB search
MSIVDNKKAFFDYFIEERFEAGLVLEGWEVKAIRAGCVHIKEAYVVIRKAELFLTGCHIT
PLLSTSTHIVPNNTRTRKLLLNAIEIRKLIGKVEQKGYTLVPLNLHFSKGNVKCEIGLAR
GKKQHNKRAATKEREWEVQKGRIARGDLNA
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgtcgataacaaaaaagccttctttgattattttatcgaggagcgctttgag
gccggacttgtgctggaaggctgggaagtgaaagccatccgcgcaggctgcgtgcacatt
aaagaagcgtatgtcgtcattcgcaaggcggagctattcctgactggctgccatatcacc
cccctgctatcaacctcaacccatattgttcccaacaacacccgcaccagaaagctctta
ctcaacgccattgagatccgcaaactgattggtaaggttgagcaaaaaggctataccctc
gttccactgaacctgcatttctccaaggggaatgtgaagtgcgaaattggcctcgctaga
ggcaaaaagcagcataacaagcgagcagccaccaaagagcgagagtgggaagtgcaaaaa
ggccgtattgccagaggcgatttaaacgcttaa

DBGET integrated database retrieval system