KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0527Help
Entry
Pnec_0527         CDS       T00683                                 

Definition
(GenBank) cyclase/dehydrase
Organism
pne  Polynucleobacter necessarius subsp. necessarius
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
474614..475045
Genome map
AA seq 143 aa AA seqDB search
MADVYKTVLIGQSADRMYGLVTDVARYPEFLPWCGAVEIFEQTETILDAKINIHFKGINQ
YFHTRNVNHRPETIDMVFVDGPFKHFSGQWNFIPLREDACKVEFKLHWEFKSVILDKIIG
PVFGHIAGTFVDCFVKRAEELYG
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgtctacaagaccgttttaattggccaatcagccgaccgcatgtacggcttg
gtgacggatgttgctcgctatcccgagttcctgccatggtgcggtgcggtcgaaattttt
gagcagaccgagaccatacttgatgccaaaatcaatattcatttcaagggcattaatcag
tactttcatactcgtaacgtgaatcaccgcccagaaacgattgatatggtctttgtagat
ggtccgtttaagcacttttctgggcagtggaactttatccctttgcgagaggacgcctgc
aaagtcgagttcaagctccattgggaatttaagagcgttatcttagataagatcattggc
cccgtctttggccatattgctggcacctttgtggattgttttgtaaagcgtgccgaagag
ctctatggctga

DBGET integrated database retrieval system