KEGG   Polynucleobacter necessarius: Pnec_0527Help
Entry
Pnec_0527         CDS       T00683                                 

Definition
(GenBank) cyclase/dehydrase
Organism
pne  Polynucleobacter necessarius
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polyketide_cyc Polyketide_cyc2
Motif
Other DBs
NCBI-ProteinID: ACB43790
UniProt: B1XTW3
Position
474614..475045
Genome map
AA seq 143 aa AA seqDB search
MADVYKTVLIGQSADRMYGLVTDVARYPEFLPWCGAVEIFEQTETILDAKINIHFKGINQ
YFHTRNVNHRPETIDMVFVDGPFKHFSGQWNFIPLREDACKVEFKLHWEFKSVILDKIIG
PVFGHIAGTFVDCFVKRAEELYG
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgtctacaagaccgttttaattggccaatcagccgaccgcatgtacggcttg
gtgacggatgttgctcgctatcccgagttcctgccatggtgcggtgcggtcgaaattttt
gagcagaccgagaccatacttgatgccaaaatcaatattcatttcaagggcattaatcag
tactttcatactcgtaacgtgaatcaccgcccagaaacgattgatatggtctttgtagat
ggtccgtttaagcacttttctgggcagtggaactttatccctttgcgagaggacgcctgc
aaagtcgagttcaagctccattgggaatttaagagcgttatcttagataagatcattggc
cccgtctttggccatattgctggcacctttgtggattgttttgtaaagcgtgccgaagag
ctctatggctga

DBGET integrated database retrieval system