KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0529Help
Entry
Pnec_0529         CDS       T00683                                 

Definition
(GenBank) inosine-5'-monophosphate dehydrogenase
  KO
K00088  
IMP dehydrogenase [EC:1.1.1.205]
Organism
pne  Polynucleobacter necessarius subsp. necessarius
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pne00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Pnec_0529
Enzymes [BR:pne01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.205  IMP dehydrogenase
     Pnec_0529
Exosome [BR:pne04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Pnec_0529
  Exosomal proteins of breast cancer cells
   Pnec_0529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
475415..476878
Genome map
AA seq 487 aa AA seqDB search
MRLIQKALTFDDVLLIPAYSSVLPRDASLASKLTRDISLNTPLVSAAMDTVTEGRLAIAM
ASEGGIGIIHKNLKPADQAREVAKVKRYESGVLRDPITISPDVTLRQVIQLSREHGFSGF
PVLVGKEVEGIITNRDLRFEEDLDAPVKSRMTPRERLITVKEGCSLDEAKRLMSQHRLER
VLVVNDKFELRGLITVKDILKATEHPNACKDGEGKLRVGAAVGVGPDNDERTELLVRAGV
DVIVVDTAHGHSQGVLDRVKWVKKNYPHVQVIGGNIATGDAAKALADHGADGVKVGIGPG
SICTTRIVAGVGVPQITAIVNVATALKGTGIPLIADGGVRYSGDVAKALAAGASSVMMGG
MFAGTEEAPGEVFLYQGRSYKSYRGMGSLGAMADGSADRYFQSDIVASAEKLVPEGIEGQ
VPYKGSVLAILHQLTGGIRSSMGYLGCKTIAELHEKANFVEITSAGVRESHVHDVKITKE
APNYHID
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgcgactcattcaaaaagcactcacttttgacgatgtgctcctcataccggcatattca
tcggtactccctcgagatgccagcttggcaagtaagttaactcgagatatttcactcaat
acaccattggtgtccgctgctatggatactgtgaccgaaggtcgtttggcaattgccatg
gccagcgaaggtggtattggcatcattcacaaaaacttaaagccagctgaccaagctcgt
gaagtagcgaaagtaaagcgctatgaatctggtgtgctacgtgatccgatcaccattagc
ccggacgtgaccttgcgtcaagtcattcagctttctcgtgagcatggcttttcaggattc
ccagtgctcgttggcaaagaagtggagggcattattacgaaccgcgatttgcgttttgaa
gaagatttagatgcaccagtaaaaagcaggatgactccgcgtgagcgtttgattaccgtc
aaggagggttgctcattagatgaagcaaagcgcttgatgagtcagcatcgcttagagcgc
gtattggtcgttaacgacaagtttgaattgcgtggcttaattactgttaaagatattctg
aaggctactgaacatcctaatgcttgcaaagacggcgaaggtaagctgcgcgtgggcgcg
gcggttggtgttggtcctgataatgacgaacgtactgagctattggtacgcgctggcgtt
gatgtgatcgttgttgatactgcgcacggtcatagtcagggtgttttagaccgcgtgaag
tgggttaagaaaaactaccctcatgtgcaagtgattggtggcaacattgctactggcgat
gctgcgaaggcattggctgatcatggtgccgatggtgtgaaagtcggtattggccctggt
tcaatttgtactactcgtattgttgctggtgtcggcgttccacagattacagcgattgtg
aatgtggcgactgcacttaaaggcactggcatcccattgattgctgatggtggcgttcgt
tactctggtgacgttgcaaaagcattggccgcaggagcaagttcagtgatgatgggtggc
atgtttgctggaactgaagaagctcctggcgaagtgttcttgtatcaagggcgctcatat
aagagttatcgcggaatgggttctttgggtgcgatggcggatggttctgccgatcgttat
ttccaaagtgacattgttgcgagtgcagagaaacttgttccagaaggtatcgaaggtcaa
gtgccatacaaaggtagtgttttggcaatcttgcatcagctaactggtggtattcgttct
tccatgggttatcttggttgcaaaaccattgctgagctccatgaaaaagccaactttgta
gaaattacatctgctggtgtgcgcgagtctcacgtacatgatgtgaagatcactaaagaa
gcaccaaattaccatattgactaa

DBGET integrated database retrieval system