KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0531Help
Entry
Pnec_0531         CDS       T00683                                 

Definition
(GenBank) protein of unknown function DUF455
Organism
pne  Polynucleobacter necessarius subsp. necessarius
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
478541..479338
Genome map
AA seq 265 aa AA seqDB search
MLELRAASLAILAAADVQIKVSQLLRLFDEYQRQRVSLNISTKIDPEGLILPGRPIKPEL
VLPKLVPKRRMDTSEGRAGLLHSLAHIEFNAMNLALDAIWRFPDMPREYYEDWLKVAKEE
AYHFSLVNEHLHTLGFTYGDFPAHNSLWEMVERTTDSVIARMALVPRTMEARGLDAVPMI
RDRFKQIRELRAVEILEIILNDEIGHVLIGNRWFNFLCDKDGLSPIATYRELARNYRAPV
LKGPFNIEARKRAGFTAEELSLLEA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaattacgagccgcatcactcgcaatcctggcggctgctgatgtgcagattaaa
gtaagtcagttacttcgcctgtttgatgaatatcagcggcaacgtgtatctctgaatatt
tctaccaagattgatcctgaagggctaatccttccggggcgtcccatcaagccagagctg
gtgcttcccaagctggttcctaaaagaagaatggatacgtctgaaggtagggcgggttta
ttgcactcgcttgcgcatattgaatttaatgccatgaatcttgccttggatgcgatttgg
cgttttccggatatgcccagggagtattacgaggactggctcaaggttgccaaggaagag
gcttatcactttagtctagtaaatgagcatctgcacacccttggctttacttatggggat
tttccagcccacaatagcctgtgggagatggttgagagaacaacagattcagtaattgcc
agaatggcgcttgtccccagaaccatggaggcgagaggattagatgcggtgcccatgatt
cgagatcgctttaagcaaatcagagaacttagggcggttgagattctcgagattattctc
aacgatgaaattggccatgttctgattggcaatcgttggtttaatttcttatgcgacaaa
gatggcctttccccgattgccacttatcgagagctggctagaaattatcgagcgcctgtc
ttaaaaggacccttcaatattgaggcccgtaagcgggcgggctttaccgctgaagagtta
agtcttcttgaggcttag

DBGET integrated database retrieval system