KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0533Help
Entry
Pnec_0533         CDS       T00683                                 

Definition
(GenBank) radical SAM domain protein
Organism
pne  Polynucleobacter necessarius subsp. necessarius
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
480808..481224
Genome map
AA seq 138 aa AA seqDB search
MTKGFSDAGILVHAYLMYGFPTQTVQETIDALEYVKQLFEAGCIQSGFFHRFICTVHSPV
GLNPQEYGVELVPLPQITFAKNDVAFIDPNGADHDALGQGLKRPSTTTCMGLDLILKSAL
GLKVWVLVFPRQRYLEIS
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaaaggtttctcggatgctggcattttggtgcatgcctatctgatgtatggtttt
ccaactcaaacagtacaagagaccatcgatgccctggagtatgtaaaacaactttttgag
gctggctgtattcagagtggcttctttcatcgttttatttgtacggttcactcaccagtg
gggctaaatccccaagagtatggtgttgaattggtgccattgccccaaattacgtttgcc
aaaaatgatgtggcctttattgatcctaatggggcagatcacgatgcattaggccaaggc
ttaaaaaggccatctacaactacatgcatggggttggatttgatattgaagtccgcgctt
ggtttaaaggtttgggtattagtattcccaagacaacggtacctagaaatttcatag

DBGET integrated database retrieval system