KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0540Help
Entry
Pnec_0540         CDS       T00683                                 

Definition
(GenBank) hypothetical protein
Organism
pne  Polynucleobacter necessarius subsp. necessarius
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
483387..483518
Genome map
AA seq 43 aa AA seqDB search
MTNKQPIISITRRLEFDSGHRIPIMMASAAIFTAIAMLLNTNW
NT seq 132 nt NT seq  +upstreamnt  +downstreamnt
atgactaataaacaacctatcatctctattactcgccgccttgagtttgactcggggcat
cgtattccaatcatgatggccagtgccgccatcttcacggccatcgctatgctattgaac
actaactggtga

DBGET integrated database retrieval system