KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0541Help
Entry
Pnec_0541         CDS       T00683                                 

Definition
(GenBank) 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
  KO
K01737  
6-pyruvoyltetrahydropterin/6-carboxytetrahydropterin synthase [EC:4.2.3.12 4.1.2.50]
Organism
pne  Polynucleobacter necessarius subsp. necessarius
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pne00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Pnec_0541
Enzymes [BR:pne01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.50  6-carboxytetrahydropterin synthase
     Pnec_0541
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.12  6-pyruvoyltetrahydropterin synthase
     Pnec_0541
Transfer RNA biogenesis [BR:pne03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    Pnec_0541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
483520..483783
Genome map
AA seq 87 aa AA seqDB search
MADHPGKADDGMVLDFGDIKRLTNQYIVDLWDHAFLVAKEDEGLVAFLSTLPNHKTVIME
HVPTVENLANAAFSILKPVFSKALVAA
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
gtggcggatcaccccggtaaagcagatgatggcatggtgctggattttggcgatatcaaa
cgcttaaccaatcaatacattgttgatctttgggatcatgcatttttggttgccaaggaa
gatgaggggttggtagcctttttgtcgaccctgcctaaccacaagacagtgattatggag
catgtgccaacagtagaaaatcttgcaaatgctgccttttctatattgaagccagtgttt
agtaaggctttggtggctgcttag

DBGET integrated database retrieval system