KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0542Help
Entry
Pnec_0542         CDS       T00683                                 

Definition
(GenBank) CMP/dCMP deaminase zinc-binding
  KO
K11991  
tRNA(adenine34) deaminase [EC:3.5.4.33]
Organism
pne  Polynucleobacter necessarius subsp. necessarius
Brite
Enzymes [BR:pne01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.33  tRNA(adenine34) deaminase
     Pnec_0542
Transfer RNA biogenesis [BR:pne03016]
 Prokaryotic Type
  tRNA modification factors
   Deaminases
    Pnec_0542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
483845..484303
Genome map
AA seq 152 aa AA seqDB search
MTQAALDQQYMRMAIEQAQLAAQAGEVPVGAVLVKDGQVIAKAFNKPIANHDPSAHAEML
ALREAALAQENYRIPGSTLYVTLEPCAMCSGAMLHARIDRVVFGAPDPKTGAAGSVLDLF
ASKQINHQTSVEGGIMSEECGQLLRDFFKRRR
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaagctgcgcttgatcagcaatatatgcgcatggcaattgagcaagctcagttg
gcggcgcaagcaggcgaggttcctgtgggtgcagtattggttaaggatggccaggtgatt
gcaaaagcatttaataagccaattgcaaatcatgatcccagtgctcacgcagaaatgttg
gctttgcgagaagcggcgttagcccaagaaaactatcgcattcctggcagtactttatat
gtcactttagagccgtgtgcaatgtgctcaggtgctatgctccatgctaggattgaccgt
gtggtctttggtgcgcctgatcctaagacgggtgctgcaggcagcgtgctcgacttattt
gcttctaagcaaatcaatcatcagaccagcgtagaaggtggcatcatgagtgaagagtgt
ggtcagctattgcgtgatttttttaagagacgacgttga

DBGET integrated database retrieval system