KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0550Help
Entry
Pnec_0550         CDS       T00683                                 

Definition
(GenBank) 4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferase of PMT family-like protein
Organism
pne  Polynucleobacter necessarius subsp. necessarius
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(489907..491418)
Genome map
AA seq 503 aa AA seqDB search
MRHQSPSSWAVICVFIAAVIHLALGFSIEFSVDEAHYALYAQHLALSYFDHPPLVGWIQW
PLVALTSSEGVIRSIPELLWIISCYLVYRVTIEIHRLIQGRNAGYLTSTLPSANLCGLFA
VLVVSAAPMLHVLAIGLLPDTLLAPLSLGLMLMALRWLRKDQFSIGDWILTGALLGLAGL
SKYTAAFTAFAFLFVFLSTPRKSWLTKAGFWLALLLALLIITPVLYWNWTNDWISFKYQL
AHGGGSEWLWRRLAAYVGIQIAVFGPVLILGSFIFLKDCMHGSKLSLLALLGFFLIPFAI
FTGLSGGGGLPHWTSPAWFCLAPFAGIGLAKTWAMQHRNWIRILFCIQMTLCCIGFGYVL
SGGISSASIKSNPIADLYGWKVAGQKSAVLAKATKADGIAVQNWTLGSRAAWYASPTPVF
VLDQQQDQFDLWFEKLPIGANILLINWSGMPYAAPVGNNSGFQVCEPLDSLEIVRFGRVL
SKFDFSLCSNWQGLRVIPPNSRP
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgcgccatcaatcaccctcaagttgggccgtaatctgcgtctttattgctgcagtgatt
catttggccctaggcttttcaatcgaattttcagtagatgaagctcactatgctttgtat
gcccaacacttggcattgagttattttgatcacccgcccttggtaggttggattcagtgg
cctttagtagctctcacctcttcggagggtgtcattcgttccattccagagctactgtgg
attatttcttgctacttggtctacagagtaactattgaaatacaccgcctcatacaagga
cggaacgcaggctatctcacgagtacacttccatcagcaaatttatgtggcctatttgca
gtattagtcgtcagtgccgcccctatgctacatgttttagcaattggtttattgccagat
accctattggcacctttaagccttggtttaatgttgatggctcttcgttggttgagaaag
gatcaatttagtattggcgactggattctaactggcgctctattaggtctggctggtctt
agcaaatacacggctgccttcaccgcatttgctttcctctttgtatttcttagcactccg
agaaaatcatggttaactaaagctggcttctggctagccttattattggccttactcatc
atcactcccgtcctgtattggaattggactaacgattggatttcatttaaatatcagctc
gcccacggtggtggtagtgaatggctctggcgcagattagccgcctatgtcggcatccaa
atcgctgtatttgggccggtattgatcttggggagttttatttttctcaaagactgcatg
catggcagcaaactgtccttacttgcactcttaggattctttttaattccctttgcgatc
tttaccggactttctggtggaggtggcctgcctcactggacttcacccgcatggttttgc
cttgcaccctttgccggcattggcttagcaaaaacatgggcaatgcaacaccgaaattgg
attcgcattttattttgcattcaaatgactctctgttgcatcggctttggctatgtctta
tctggtggcatcagctcagcttcgattaaatctaatccgattgcagatttatatgggtgg
aaagttgccggccaaaaatcagcagtgttagcaaaagccactaaagccgatggcattgcc
gttcagaactggactttaggcagccgtgctgcttggtacgcatctccgactccggtgttc
gtcttagatcagcaacaagatcaattcgacctctggtttgagaaactcccaattggggca
aatattctcctaattaactggtctggcatgccctatgctgcaccagtaggcaataattcg
ggatttcaggtatgtgagcccttagatagcctagaaattgtgcgatttggccgagtttta
tccaaatttgactttagcctttgcagtaactggcaaggcctcagagtaattcccccaaac
tcaagaccttag

DBGET integrated database retrieval system