KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0560Help
Entry
Pnec_0560         CDS       T00683                                 

Definition
(GenBank) protein of unknown function DUF59
  KO
K03593  
ATP-binding protein involved in chromosome partitioning
Organism
pne  Polynucleobacter necessarius subsp. necessarius
Brite
Chromosome [BR:pne03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    Pnec_0560
Mitochondrial biogenesis [BR:pne03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-I assembly factors
    Pnec_0560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
496664..497752
Genome map
AA seq 362 aa AA seqDB search
MSFTPELVQAALKNLVAPNTRVDFVTAKNIKNLRVEEGDISLDLILGYPAKSQFDSIRKS
VINALRELSGVKNVSVNVSSQIVAHAVQRGVKLLPGVKNIIAVASGKGGVGKSTTAVNLA
LALSAEGAQVGILDADIYGPSQPMMLGITGRPNSLEENTIEPMEAYGLQASSIGFLIDDD
APMVWRGPMVTSALEQLLRQTRWRDLDYLIVDMPPGTGDIQLTLAQKVPVTGSVIVTTPQ
DIALLDARKGLKMFEKVGVPIIGIIENMSTYVCTKCGHEEYVFGIGGGEKMCAEYKVDFL
GSLPLNLSIREQADAGRPAVVADPDGAISAIYKGIARQVAIRVATLSKDMSSKFPNIVVQ
NT
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgtttacaccggaattggtacaagcagcccttaaaaacttagtcgcccctaatacc
agggttgattttgttactgcaaaaaatattaaaaatcttcgtgtagaagaaggtgatatt
tccttggatcttattttgggatatccggccaagagtcagtttgactctattcgtaaatcg
gttattaatgctttgcgtgaactgtccggcgttaagaatgtcagtgtcaatgtaagcagt
cagattgttgctcatgcggtgcagcgtggtgtgaagcttttgcctggcgtaaaaaatatt
attgcagtcgccagcggtaagggtggggtaggtaaatcgacaacggcagtcaatttagcc
ttggctctttctgctgagggcgcgcaggttggaattttggatgcagatatctacggccca
agtcagccaatgatgttgggaatcactggcagaccgaactctcttgaagaaaatacaatt
gagccgatggaagcatatggcttgcaggcgagttcaattggttttctgattgatgatgat
gcgccgatggtgtggcgtggtccgatggtgacttctgcgcttgagcaactacttcgtcag
actcgttggcgtgatttggattatctaattgttgatatgccaccaggcaccggcgatatt
caactgaccttggcgcaaaaagttcctgttacaggttccgtgattgtgacaacacctcaa
gacattgctttgcttgatgcccgcaaaggcctaaaaatgtttgagaaggttggcgtacct
atcattggcattattgaaaacatgagcacttacgtttgcacaaaatgtgggcacgaagag
tatgtatttggtattggtggcggtgaaaagatgtgcgcagaatataaagtggacttcttg
ggatcattgcctctgaatttgtctattcgtgagcaagctgatgctggtcgccctgcagtg
gttgcagatcctgacggcgcaatcagtgcaatttataaaggcattgctagacaggttgcc
atccgtgttgctactctatccaaagatatgagcagtaaattcccgaacattgtggttcaa
aacacctga

DBGET integrated database retrieval system