KEGG   Polynucleobacter necessarius: Pnec_0562Help
Entry
Pnec_0562         CDS       T00683                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pne  Polynucleobacter necessarius
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3305
Motif
Other DBs
NCBI-ProteinID: ACB43819
UniProt: B1XTZ2
Position
498022..498249
Genome map
AA seq 75 aa AA seqDB search
MEEDIERYVDAQSIELAKVESSFAVPHRICVSYNEAARLLDGGESVDTVPMSQQHAAWLQ
EYVDENYRPEPKKTP
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
ttggaggaggatattgagcgttatgttgatgcgcagtctattgagctcgcaaaagtcgaa
tcttcttttgcggttcctcatcgtatatgtgtcagttacaacgaagctgcacgcttgctt
gatggcggggagtcagttgacacggttccaatgagtcaacaacatgcagcctggttgcaa
gagtatgttgatgaaaactatcggcctgaaccaaaaaaaacgccataa

DBGET integrated database retrieval system