KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0563Help
Entry
Pnec_0563         CDS       T00683                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pne  Polynucleobacter necessarius subsp. necessarius
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
498489..498641
Genome map
AA seq 50 aa AA seqDB search
MRPDVDPTVQQAALKEMFTDPHFNVMDGLDIYIDDYSKPDPFCYQECSSE
NT seq 153 nt NT seq  +upstreamnt  +downstreamnt
atgaggccagacgtcgaccccaccgtgcagcaagctgctcttaaggagatgttcaccgat
ccacatttcaatgtaatggatgggttagatatttatatcgatgattacagtaagccagac
cctttttgctaccaggaatgctcgagcgaatag

DBGET integrated database retrieval system