KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0564Help
Entry
Pnec_0564         CDS       T00683                                 

Definition
(GenBank) 4Fe-4S ferredoxin iron-sulfur binding domain protein
  KO
K00124  
formate dehydrogenase iron-sulfur subunit
Organism
pne  Polynucleobacter necessarius subsp. necessarius
Pathway
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pne00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pnec_0564
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Pnec_0564
  Energy metabolism
   00680 Methane metabolism
    Pnec_0564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
498626..499384
Genome map
AA seq 252 aa AA seqDB search
MLERIAQSDMLNLFSKATEVAQEGVKDAAQAVDLPFEASKLEAQQQTDLTSTDQKLSARL
DEVPWGVNRRRVVTVHDGIIGQEKSVSVACMHCSDAPCMAVCPVDCFYRTDEGVVLHDKD
ICIGCGYCSFACPFGAPQFLSKGAFGSCSKMDKCTFCSGGPEENGSVAEFEEYGRNRLAE
GKLPLCAEMCSTKTLIGGDSNIISGIFNNRVATREKNGKYPGSKAFGWTTAYGGPDTPAP
TPTPAAKIPGAK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgctcgagcgaatagcgcagagcgatatgttgaatctattcagtaaggcgactgaagtg
gctcaagagggtgtaaaagatgcggcccaagccgtcgatctaccgtttgaagctagtaaa
ttagaggcacaacagcaaactgatttaacatccacagaccaaaaactctccgctcggtta
gatgaagtgccttggggtgttaaccgtcgtcgtgttgtaacggtgcatgacggcattatt
ggtcaagaaaaatcagtttcagttgcttgtatgcactgtagcgatgcaccttgtatggcg
gtatgtccggttgattgcttctatcgcacggacgaaggcgttgtgttgcacgataaagat
atctgtatcggttgcggctactgctcttttgcttgcccatttggtgcgcctcagttcttg
agcaagggtgccttcggttcctgcagcaagatggataagtgcacattctgtagtggtggc
ccagaagaaaacggcagtgttgctgaatttgaggagtatggacgcaatcgcttggcagaa
ggcaagttgccgctctgtgccgaaatgtgctctaccaaaaccttaattggtggcgatagc
aatattatttctggcatcttcaataatcgcgttgctactcgcgagaagaatggtaagtac
ccaggatccaaagcctttggttggactactgcgtatggtggcccagatactccagcgcca
acaccaacacctgctgcaaaaatcccaggagctaaataa

DBGET integrated database retrieval system