KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0565Help
Entry
Pnec_0565         CDS       T00683                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pne  Polynucleobacter necessarius subsp. necessarius
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
499384..499620
Genome map
AA seq 78 aa AA seqDB search
MKFNFKTLGLCFAAATLLVACSEPPEIAAKAAKRPDVAPYMGANNGFMTKNWTPGNQASW
TESIDKRTQGQNEYSHVK
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcaatttcaaaactctcggtttatgttttgcagcagcaacgttgttggtcgct
tgctctgagcctccagaaattgcagctaaagctgctaagcgtccagacgttgctccttac
atgggtgccaataacggttttatgacaaagaattggacgccaggcaatcaagcgagttgg
actgagtcaattgacaagcgcactcagggtcaaaacgaatacagtcacgttaagtga

DBGET integrated database retrieval system