KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0566Help
Entry
Pnec_0566         CDS       T00683                                 

Definition
(GenBank) formate dehydrogenase, gamma subunit
  KO
K00127  
formate dehydrogenase subunit gamma
Organism
pne  Polynucleobacter necessarius subsp. necessarius
Pathway
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pne00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pnec_0566
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Pnec_0566
  Energy metabolism
   00680 Methane metabolism
    Pnec_0566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
499668..500186
Genome map
AA seq 172 aa AA seqDB search
MKRSFSKVLRTLVVAASLSLTLASGISFAERAPMAPLPSPSGVDVSPLSVPANPSALANG
TQAQAQPANPSIFTSANSDPYNYVSIPDKEASVLIQRSGQQWRVIRNGVITVFGDWLLAL
AFFGIIATYTLKGPMKLHEPMSGVKIKRFSAFDRLVHWLMAFSFLALAFTGQ
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgatcattttctaaagttctacgcactttggtagtggctgctagtttgtcgctg
actttggcaagtgggatcagttttgctgagcgcgcgccgatggcgccacttccgtcaccg
agcggggtggatgtttcacctttgtcagtgccagcaaatcccagtgccttggcaaatgga
actcaagcgcaggctcagccagcaaacccatcgatttttacttccgcgaatagcgatccc
tataactatgtcagcattccagacaaagaagctagcgttttaattcagcgctctggtcaa
cagtggcgtgtgattcgtaatggtgtgatcactgtgttcggcgattggttgctcgcattg
gcatttttcgggattattgcaacctacacgctcaaaggccctatgaagttacatgagcca
atgtctggtgtaaagattaagcgcttcagtgcctttgatcgcctagttcactggttgatg
gcatttagctttttagcattggctttcactggccagtag

DBGET integrated database retrieval system