KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0567Help
Entry
Pnec_0567         CDS       T00683                                 

Definition
(GenBank) ABC transporter related
  KO
K06857  
tungstate transport system ATP-binding protein [EC:3.6.3.55]
Organism
pne  Polynucleobacter necessarius subsp. necessarius
Pathway
ABC transporters
Module
Tungstate transport system
Brite
KEGG Orthology (KO) [BR:pne00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Pnec_0567
Enzymes [BR:pne01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.55  tungstate-importing ATPase
     Pnec_0567
Transporters [BR:pne02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Tungstate transporter [MD:M00186] [OT]
    Pnec_0567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(500228..500935)
Genome map
AA seq 235 aa AA seqDB search
MDNPQEQFTKFIELKEITVKSNGRAILDIPYAIIPADRITACIGPNGAGKTTFLKLLDDL
IKPDTGTVSHSFKTKTALVLHHTPMIKASAKTNLRMVRDVDASIKTADIERVITQVGLGN
LADSPAHKLLAGERQKLCLGRAILQKPNLVLLDEPTANLDPNTTEQVEDLIRQFDSQGTD
VIFSSHQLAQVQRLAEHILFIDQGQIKERGPAGPFFENPQTQAAKRYLHQELLAD
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggataacccacaagagcaatttaccaagttcattgaactcaaggaaattactgtcaaa
agcaatggcagggcaatcctcgacattccttacgccatcattcctgcagatagaattacc
gcctgcattggccctaatggagcaggcaagactactttcctaaagttgctagacgacctg
attaaacccgatacaggaacagtgagccactccttcaaaacgaagactgctttggtttta
catcacacgccaatgatcaaagcttcagcaaaaaccaatctacgaatggttcgagacgtt
gatgcatctataaaaacggctgatatagaacgtgtgattacccaagttggcttgggtaat
ctagccgacagtccggcgcataagttattggcaggagaaagacaaaaactttgccttgga
agagccattctgcagaagccgaatttagttttgctggatgagcctactgcaaatcttgac
cccaacactaccgaacaagttgaagacctcattcgtcagtttgatagtcaaggtacagat
gtgattttttcatcccatcaacttgctcaggtgcaaaggcttgcagagcatattctattt
attgaccaaggccagataaaagaaaggggacccgcaggccccttctttgaaaatcctcaa
acacaagcagctaaacgctacctacaccaggagttgctcgccgactaa

DBGET integrated database retrieval system