KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0569Help
Entry
Pnec_0569         CDS       T00683                                 

Definition
(GenBank) binding-protein-dependent transport systems inner membrane component
  KO
K05773  
tungstate transport system permease protein
Organism
pne  Polynucleobacter necessarius subsp. necessarius
Pathway
ABC transporters
Module
Tungstate transport system
Brite
KEGG Orthology (KO) [BR:pne00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Pnec_0569
Transporters [BR:pne02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Tungstate transporter [MD:M00186] [OT]
    Pnec_0569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(501192..501611)
Genome map
AA seq 139 aa AA seqDB search
MLKAFQDALSLLGGVLGIVLVSLQVSLSTLFIGTLLGLPIGALLATEQFTGKKSIIVTLN
TLMGVPTVIVGVLVYLMLSRSGPLGAWGWLFTPKGIIVAQTLLTTPLIAALSRQILEDFW
KIHRDSFLSLRLPPLSRFK
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaagcttttcaagatgccctttctctgcttggaggggttttgggaatcgtctta
gtgtccctgcaagttagcttgagcaccctttttattggaacgctattgggtctccccatt
ggggccctcttagcaacagagcaatttactggtaaaaaatcgattattgtgaccctcaat
actctgatgggcgttccaacggtaatcgtgggtgttcttgtttacttaatgctatctcgc
tcagggcccttgggggcatggggatggttatttacacccaaaggcataatcgtagcccaa
accctgcttacaacccctctaatagccgcccttagcaggcaaattttggaagacttctgg
aaaatccatcgcgattcttttttgagcctcagattaccacctctatctcgttttaagtag

DBGET integrated database retrieval system