KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0570Help
Entry
Pnec_0570         CDS       T00683                                 

Definition
(GenBank) Endonuclease/exonuclease/phosphatase
Organism
pne  Polynucleobacter necessarius subsp. necessarius
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
501635..502387
Genome map
AA seq 250 aa AA seqDB search
MGTSNSSRFTVLSMNVHKGLSPLHRHSTIYQLREKMRTHYPDLLFLQELQQEHRGRVRRF
GQWPMAELTHFLSEEFWQHWHYGKNVEYRDGHHGNAILSKHPQQKGNNYDISAYRFESRG
LLHSVTRIDGVDKSIHCFCVHLALFERGRERQLEAIIGHIQDLTGGGPTIVAGDFNDWRN
RVSAPMKAAGFDEVFEMLTSSPAKTFPSVKPLLPMDRIYVRGLKVHSAQILHEWLKLSDH
LGITAELELV
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgggtacaagtaattcttctcgctttaccgttttgagtatgaatgttcacaaaggttta
tcgcctttgcatcgacactcaacaatttatcagttgcgcgaaaaaatgcgtacccactat
ccagaccttcttttcttgcaagaactgcaacaggagcatcggggtagggtgcgccgattt
ggacagtggccgatggctgaattaactcattttttatcagaagaattttggcagcactgg
cattatggaaagaatgtcgagtatcgtgatggccatcatggcaatgccattctctctaag
catcctcaacaaaagggaaataactacgacatatctgcatatcgttttgaaagtcgtggg
ctacttcatagtgttacgagaatagatggtgtggataagtccattcattgtttttgcgtg
catttagcactctttgagcgaggcagagagcggcagttggaggcaatcattggccacatt
caggatttgacaggtggcggccctacaattgttgcgggagactttaatgattggcgcaac
cgtgtgagcgcgccgatgaaagctgcaggctttgatgaggtttttgaaatgcttaccagc
tctccagcaaagacatttccgagtgtcaaaccactgcttcctatggacaggatctatgtc
cgtggtttaaaagtgcattctgcacaaattttgcatgaatggctcaagctatcagatcat
ctgggcattaccgctgaattggaacttgtatga

DBGET integrated database retrieval system