KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0571Help
Entry
Pnec_0571         CDS       T00683                                 

Definition
(GenBank) phospholipase D/Transphosphatidylase
  KO
K06131  
cardiolipin synthase A/B [EC:2.7.8.-]
Organism
pne  Polynucleobacter necessarius subsp. necessarius
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pne00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Pnec_0571
Enzymes [BR:pne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.-  
     Pnec_0571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
502384..503859
Genome map
AA seq 491 aa AA seqDB search
MNIIAFVFGSVFGISLIWVPIAHAIIVFLFGIHLISVRRPVGVAFAWFLIVILLPILGIS
LYVLIGERPVGRKLTRKIVRMNREYEKLTEVMRQEFVNDRKNLPIEGRALSLLAESKNGS
PVVAGNKIELHTKSLDILQKFIDEINEAKKSLHLEFYIWALGGDADRVGEALIAAAKRGV
ACRVLLDSLGSASWFKSKWPGRFRNAGIQVTEALPIQIGRFQFRRADLRLHRKIFVVDGS
IVWTGSMNMIDPRTFKQDSGVGEWVDAMVRIEGPVASQFELTFIFDWSVDNPNITNFRDR
EPPSSPHAGGALAQEFSSGPVYRDDILYQVLLSAIMDAREELTITTPYFGPDDGLIQALM
AAAARGVKVTLIVPKLNDSTLVAWSSKSFYEDLMNSGVTIAEFHGGLLHTKSLLIDKQIA
IFGSVNFDQRSLQLNFEISLIVYNVDFCIKLEKLIDSYLAQSDYVDPKVWVKRPTWRRYL
ENAAHLTSPLL
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaatattattgcgtttgtttttggatctgtttttggaatttccttaatttgggttccg
attgcacatgccatcattgtgtttttattcggcattcatttgatctcagtaagaaggccg
gttggggtggcatttgcatggtttctgattgtgatcttgctgcctattctcggtatttct
ttatacgtcttaattggcgagagacccgtgggtcgtaaattgacgcgcaagattgttcgc
atgaatcgtgaatatgaaaaactaacagaggtaatgcgtcaggaatttgtgaacgataga
aagaatttgcctattgagggcagggcgctgagcctattggctgagtcaaaaaatggctcg
cctgtggtggctgggaataagatcgagttacatacaaagtcactcgacatcctgcaaaaa
tttatcgacgaaattaacgaagctaaaaaaagcttacatttagagttttatatttgggct
ttgggaggcgatgctgaccgggttggcgaggctttgatagctgctgcaaaacgtggtgtt
gcctgccgtgttttattggattctttaggtagtgcaagttggtttaagtccaaatggccg
ggtcgttttcgcaatgctggtattcaggtaaccgaagcattacctattcagataggccgc
tttcaatttagacgtgccgatttacgtctgcatcgaaaaatctttgtagtagacggctct
atagtttggactggcagcatgaatatgattgatcctcgtacatttaagcaggattctggc
gtgggtgagtgggttgatgccatggtgcgcattgagggcccagttgcatcgcagtttgag
ctgacttttatatttgattggagcgtcgataacccaaatatcactaactttagagatcgt
gaaccgccttcatctcctcatgcagggggcgctttagcccaagagttttcgtctggaccg
gtttatcgcgatgatattttgtatcaggtattgctttcagccatcatggatgcgcgcgaa
gagctgaccatcaccaccccctattttggacctgatgatggtttgatacaggctctgatg
gctgctgcagcaagaggtgttaaggtaacgctgattgttcctaagttaaacgattcgacc
ttagttgcttggagtagcaagagcttctatgaggatctgatgaattcaggggttacgatc
gctgaatttcatggcggcctgttacatactaagagtttgttgatcgataaacagattgcg
atatttggttcagtgaattttgatcagcgcagcttacaactgaactttgaaattagtctg
attgtctacaacgtagatttctgtattaaattggagaagttaatcgattcctatttagcg
caatccgattatgttgatccaaaggtttgggtgaagcgaccaacgtggcgtcgctatctt
gagaatgctgctcacctcacgtcaccactactttaa

DBGET integrated database retrieval system