KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0572Help
Entry
Pnec_0572         CDS       T00683                                 

Definition
(GenBank) L-carnitine dehydratase/bile acid-inducible protein F
Organism
pne  Polynucleobacter necessarius subsp. necessarius
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(503890..504444)
Genome map
AA seq 184 aa AA seqDB search
MLESLGEWMSFPMYYAYKGAEPPPRNGASHATIYPYGPFKAGDGKTVMLGLQNEREWVQF
CETILENSALAVDERFDRNFKRNGKRAELLEIINACFSKLTSEQLIAKLEKAQIANAHLN
DMAGLWKHEQLKARNRWTEVGSPNGTIAALLLPGLNDSYDYRMDPICGWGAHRLHPQRTW
NSGV
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaatctcttggtgaatggatgagttttccaatgtattacgcctacaagggtgct
gaaccacccccaagaaacggcgcatcacatgcaaccatttacccatacggaccctttaag
gctggcgacggtaagactgtcatgctgggcctacaaaatgaacgggaatgggtgcagttc
tgtgagaccatattagagaattctgcgcttgctgtggatgagcgatttgatcgcaacttc
aagcgcaatggtaagcgcgcagagttgcttgaaattattaatgcctgctttagcaagctc
acttcagagcaattaattgccaaattagagaaagcgcaaattgcaaatgctcatctcaat
gatatggcgggtctttggaagcatgaacaacttaaagcgcgcaatcgctggactgaagtg
ggcagtccaaatggcaccattgccgcccttctgctcccaggcctcaacgatagttatgac
taccgcatggaccccatctgcggttggggagcacaccgactccatcctcaaagaacttgg
aatagcggagtctga

DBGET integrated database retrieval system