KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0576Help
Entry
Pnec_0576         CDS       T00683                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pne  Polynucleobacter necessarius subsp. necessarius
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
506713..507306
Genome map
AA seq 197 aa AA seqDB search
MASILTSLGRTVFAGFVLLALIILALGGNFSSAELPFVFRWLHVMFGVMWIGLLWYFNFV
QIPSMPKIPDEQKPAIGKVIAPTALFWFRYAALFTVVTGLIVAALSGYLHQAFTLQAPFR
AIGLGMWIALVMAFNVWFIIWPNQKRALGIVAVEADVKAKSARVAMLTSRLNTLLSVPML
FLMVAQSHNTTWFVIVS
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaatcttgacctctttaggacgcaccgtttttgcgggcttcgttcttcttgct
ttaattattcttgctttgggcggtaactttagctctgctgaactcccatttgttttccgt
tggttgcacgtgatgtttggtgtcatgtggatcggtttgctctggtatttcaactttgtg
caaattccttctatgccaaagattcctgatgagcaaaaaccagcgattggtaaagtaatt
gctccaactgcattattctggttccgttatgcagctttgtttactgttgtgaccggattg
atcgttgcagctttaagtggctatttgcatcaagcatttacattgcaggctcctttccgc
gcaatcggtttgggcatgtggattgctttggtaatggcgtttaacgtttggttcattatt
tggccaaatcaaaagcgtgctcttggcatcgttgctgttgaagctgatgtaaaagctaaa
tctgctcgcgttgccatgttgacatcccgtttgaatacattgctatctgtgccaatgttg
ttcttgatggttgctcaatcacataacactacttggtttgtgatcgtttcttaa

DBGET integrated database retrieval system