KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0579Help
Entry
Pnec_0579         CDS       T00683                                 

Definition
(GenBank) hypothetical protein
Organism
pne  Polynucleobacter necessarius subsp. necessarius
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(508801..509010)
Genome map
AA seq 69 aa AA seqDB search
MKPLSKKAKMTIGWTVLMTVVGTAMLHQWQFFAMDCASLVLLLVANHYDLLKDPEDKKII
PPTKTGLFT
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
atgaagccactctctaaaaaagccaagatgaccataggctggacagtcttgatgactgtg
gtgggtaccgctatgttgcaccagtggcagttttttgccatggactgtgcatcactagtc
ctgctgcttgttgcgaaccactacgatctcttaaaagatcccgaagacaaaaaaataatc
ccgcctactaagacaggattattcacttaa

DBGET integrated database retrieval system