KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0580Help
Entry
Pnec_0580         CDS       T00683                                 

Definition
(GenBank) cytochrome b561
  KO
K12262  
cytochrome b561
Organism
pne  Polynucleobacter necessarius subsp. necessarius
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(509007..509309)
Genome map
AA seq 100 aa AA seqDB search
MHWLLYTLLLVSPIFGILYFQYGGKEIHFFGLVWPQLVTPNPEMKKTVEGIHKFLGNSLY
FLIAIHALAGLWQHYVLKDDTLRRMLNKVNAQTEAGAKIK
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atgcattggttgctttacactctgcttttggtatcacctatctttggcatcctgtatttt
cagtatggcggcaaagaaatccacttcttcggcttagtatggcctcagctagttacaccc
aatccagaaatgaagaaaacagttgaagggatccataagtttcttggaaactcgctctat
ttcttgatcgccattcatgccttggcaggtttatggcaacattacgtcctaaaggacgat
acacttcgtcgaatgttaaataaggtgaatgcccaaactgaagctggagcgaagattaaa
tga

DBGET integrated database retrieval system