KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0584Help
Entry
Pnec_0584         CDS       T00683                                 

Definition
(GenBank) protein of unknown function DUF6 transmembrane
Organism
pne  Polynucleobacter necessarius subsp. necessarius
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(510447..511595)
Genome map
AA seq 382 aa AA seqDB search
MHSASAAHHHRRYLYGILMAGVGSMLFSGKAILVKLAFGYGANAETLLALRMLMALPLFW
GIFWWESRRKEMSPITWLDRGKLFFLGFLGYFLSSYIDFLGLQYISAGLERIVLYLTPTI
VLLISYFVLKKPISRLQWYALVVGYIGVFIVFIQDASSTGISAWLGMFLVFGSACSYAAY
MIGAGEMVKRIGSVRLVVYASSASAVLSIAQSTIHNPSAIFEQLPQIYWYNLLTASLCTV
IPMLLIMIAINRIGSPLVAQAGILGPVSTIFMGYLILAEPITWTQISGMALVIAAMWLLV
RNDVPRKKSSDLKNLMTSMARSPSIKGVCLLNCCVGSSFRFLFRLLLCFFSRLSFLSSLS
SSPSSQQLYLLAHWPSRYSECD
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgcattcagcgagcgcagcgcatcatcaccgacgttacctctatggcattctgatggcc
ggggtaggctctatgcttttctcgggcaaggcaattctagtaaaacttgcctttggttat
ggtgcaaacgcagagacacttttagccttacgcatgctgatggcccttcctttattttgg
ggaatcttttggtgggagtctcgccgcaaagagatgagcccaattacctggcttgataga
ggaaaactgttttttctcggatttttaggttacttcttatcaagttatattgatttcctg
ggccttcagtacatctccgctggcctcgagagaatcgttctctatctgaccccaacaatt
gttctcttaatctcctattttgttttaaagaagcccatctcccgattgcagtggtatgcg
ctggttgttggttatatcggggtattcatcgtctttattcaggatgccagctctactggc
attagcgcttggctggggatgtttctagtgtttggtagcgcctgctcttatgcagcttac
atgattggggctggtgagatggtcaaacgcattggcagcgttcgcttagttgtgtacgct
agctcagcgtccgccgttttaagcattgcgcagtcaacgattcataacccatcggctatc
ttcgagcaactgccacagatctactggtataacttgctcaccgcgagcttatgtactgtg
attcccatgttgctgattatgattgccatcaatcgcattggctcaccgctagtagcacaa
gcaggaatacttggcccagtgtctactatctttatgggctatttaattttggccgaacca
atcacttggacacaaattagcggcatggctttagttatcgcggccatgtggctcttggtg
cgcaatgatgtcccaagaaaaaagtcatcagatcttaaaaatctgatgacttcgatggcg
cggagcccctcaattaagggggtttgtttactgaactgctgtgtcggcagcagctttaga
tttctttttagacttcttctttgctttttttctcggctttcttttctttcttcgctttct
tcttcaccttcttcccagcagctttatctgctggcgcactggccatcgcgatattcagaa
tgtgactaa

DBGET integrated database retrieval system