KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0585Help
Entry
Pnec_0585         CDS       T00683                                 

Definition
(GenBank) carbohydrate kinase, YjeF related protein
Organism
pne  Polynucleobacter necessarius subsp. necessarius
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(511602..512486)
Genome map
AA seq 294 aa AA seqDB search
MISPPATLDALKLAKLLKRLPTEHKGNAGKVVLTGGAPGMAGALILAGNACLHLGAGWTI
LEMLDPSSARAAVDYPELMIRLATENIQENLVNTQADVIAVGPGLGNSDLAQLCLNASLS
FPNIPLVIDADALNLISNSAKLLEQLQIRNQQFPRLTVLTPHPGEAAKLLKTSTENVQAN
RLSAIQQLVQLTQSIVVLKGEHTLIASPQHPPMQCLAGNPGMGTGGMGDVLTGSIAAIAG
QGVRHHLDLWQATSIAVELHASAADSLVSKGIGPIGLTPSETILEMRALLNKLL
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgatctccccacccgccaccctcgatgcgctgaagttagccaagctactaaagcgccta
cctacagagcataaaggtaatgcaggtaaagttgttttaacgggcggcgcacccggcatg
gcaggcgccctcattttggcaggcaatgcctgcttgcatctaggcgcaggatggaccatc
ctagaaatgctagacccaagctcggcaagggctgctgttgattatcccgaactcatgatc
cgtcttgcgacagaaaatattcaagaaaacctcgttaatactcaagctgatgtcattgcg
gttggtccaggtcttggtaactctgatttagcacaactctgcctaaatgcatcactctca
ttcccaaatattccactagtaattgatgctgacgccctcaatctcattagcaactcagcg
aaattgttggagcaactacagattcgcaatcagcagtttcctaggcttactgtcctcacc
ccccatcccggagaggcggctaaactcctcaaaacctcaacagaaaatgtacaagcaaat
cgcctaagcgctattcaacaattagttcaattaacacaatcaatcgtagttcttaaaggc
gaacacactcttatcgcatccccacaacatcccccaatgcaatgccttgctggcaacccc
ggcatgggaacaggaggcatgggagatgttttgaccggcagcattgcagccattgctggc
caaggggttcgtcaccatctagacctctggcaagccactagtattgccgttgagctccat
gctagtgcagcagatagcctggtcagcaaaggtattggccctataggacttacaccttca
gagactatattagagatgcgagccttgctaaataagctgttataa

DBGET integrated database retrieval system