KEGG   Polynucleobacter necessarius: Pnec_0590Help
Entry
Pnec_0590         CDS       T00683                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K06966  pyrimidine/purine-5'-nucleotide nucleosidase [EC:3.2.2.10 3.2.2.-]
Organism
pne  Polynucleobacter necessarius
Pathway
pne00230  Purine metabolism
pne00240  Pyrimidine metabolism
Brite
KEGG Orthology (KO) [BR:pne00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Pnec_0590
   00240 Pyrimidine metabolism
    Pnec_0590
Enzymes [BR:pne01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.10  pyrimidine-5'-nucleotide nucleosidase
     Pnec_0590
    3.2.2.-  
     Pnec_0590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lysine_decarbox
Motif
Other DBs
NCBI-ProteinID: ACB43845
UniProt: B1XU18
Position
515315..515842
Genome map
AA seq 175 aa AA seqDB search
MAANKALIHSKYYESAREFGALVAAYNTTQKKNSNKLHICTGGGPEIMEAANRGAFEAGD
KTIGFNISLPREQHPNEYITPGLSFRFHYFALRKMHFMLRARAIVAYSGGFGSFDELFEV
LTLIQTKKVVPIPVILVGKAYWNEMVNFDHMVEFGVIDQEGMHSIHFVETADEAW
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
gtggctgctaataaagcattaatacacagtaaatattacgagtcagctcgagagtttggc
gctttagtggcggcctacaacacaacccaaaagaaaaactctaacaagcttcatatttgc
acgggcggtggccctgaaattatggaagccgccaatcggggtgcctttgaggcaggagat
aaaaccatcggttttaatattagccttcctagagagcagcatccaaatgagtacattacc
cctggattgagttttcgttttcattactttgccctgcgcaagatgcacttcatgttgagg
gcgagggcaatcgtggcctactctggtggctttggctcctttgatgagttgtttgaggta
cttactctgatacagaccaaaaaagtagtgcctattccagtgatattggtaggtaaggcc
tattggaatgagatggtgaattttgatcacatggtggaatttggcgtcattgaccaagaa
ggtatgcatagcattcactttgtggaaacggccgatgaggcctggtag

DBGET integrated database retrieval system