KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0590Help
Entry
Pnec_0590         CDS       T00683                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K06966  
uncharacterized protein
Organism
pne  Polynucleobacter necessarius subsp. necessarius
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
515315..515842
Genome map
AA seq 175 aa AA seqDB search
MAANKALIHSKYYESAREFGALVAAYNTTQKKNSNKLHICTGGGPEIMEAANRGAFEAGD
KTIGFNISLPREQHPNEYITPGLSFRFHYFALRKMHFMLRARAIVAYSGGFGSFDELFEV
LTLIQTKKVVPIPVILVGKAYWNEMVNFDHMVEFGVIDQEGMHSIHFVETADEAW
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
gtggctgctaataaagcattaatacacagtaaatattacgagtcagctcgagagtttggc
gctttagtggcggcctacaacacaacccaaaagaaaaactctaacaagcttcatatttgc
acgggcggtggccctgaaattatggaagccgccaatcggggtgcctttgaggcaggagat
aaaaccatcggttttaatattagccttcctagagagcagcatccaaatgagtacattacc
cctggattgagttttcgttttcattactttgccctgcgcaagatgcacttcatgttgagg
gcgagggcaatcgtggcctactctggtggctttggctcctttgatgagttgtttgaggta
cttactctgatacagaccaaaaaagtagtgcctattccagtgatattggtaggtaaggcc
tattggaatgagatggtgaattttgatcacatggtggaatttggcgtcattgaccaagaa
ggtatgcatagcattcactttgtggaaacggccgatgaggcctggtag

DBGET integrated database retrieval system