KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0591Help
Entry
Pnec_0591         CDS       T00683                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pne  Polynucleobacter necessarius subsp. necessarius
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
515897..516409
Genome map
AA seq 170 aa AA seqDB search
MNPSQVGLATSLDLPGYLLGGSVLLLVMVFHGAVLLQIAKRYEVKSFLYLAEKKYSAVAL
CFYVSVFLLFLTHIAEILIWGTALYVFKLLPALGQSILFSGSTYTAMGFMEDILPDGWKM
LAVIIAFSGMFSFAWTASVMISMTKSFRQAYTKLHMRKLKIPSDIIDRFE
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaacccatcccaagtcggcctcgccacttcactcgatctccctggctatctcttaggt
ggctctgtgctcctattggtcatggtttttcatggtgcggtgttattgcaaatcgccaag
cgctatgaagttaaatcgtttctgtacttagctgagaaaaaatactctgctgtagcactc
tgtttttatgtcagcgtattcctattgtttttaacgcatattgctgaaattctgatctgg
ggcactgcgttatatgtatttaaattactgccagctttaggtcaaagcattttgtttagc
ggcagcacgtacacagcaatgggatttatggaggatattcttcctgatggctggaaaatg
ctagcagtcattattgcgttttctggaatgttctcctttgcatggactgcttctgtcatg
atctcgatgacgaagagctttcgtcaagcctataccaagcttcacatgagaaaactcaag
atcccatcagacatcattgatcgttttgagtaa

DBGET integrated database retrieval system