KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0592Help
Entry
Pnec_0592         CDS       T00683                                 

Definition
(GenBank) HI0933 family protein
  KO
K07007  
uncharacterized protein
Organism
pne  Polynucleobacter necessarius subsp. necessarius
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
516413..517630
Genome map
AA seq 405 aa AA seqDB search
MSKTWDAITVGGGAAGLFCAGVAGQLGKKVLVLDHAEVLGEKIRISGGGRCNFTNLHSSP
SNFLSLNQHFVKSALARYPSSEFIKLVTSYRIGYHEKHQGQLFCDDSAKQIIDMLFSECT
KGRVSIRNPVSIRSIEQVNDSWIVNTDAGVEKSKAVVMATGGLPVPAIGATAYSLDIAKQ
FGLNVVEPRPVLVPLSFTADNFGGLNELAGLSVPVRIASGSKGHRYGACRFNEDLLLTHK
GLSGPAVLQASSYWEEGEPIHIDWLGAIERPGGFNCDELFNNEENRLKLTETILASVLPQ
RLAKAFADQRNLTGRKWAEVSKKDRQALKELITNWSVKPAGTLGWKKAEVMLGGVDTKEL
DVQTMMSRKHQGLFFIGECVDVTGHLGGHNFQWAWASGFACAHAL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaacctgggatgccatcactgtcggtggcggggctgcaggcttattttgcgct
ggagttgccggtcagctaggcaagaaagtgcttgtgctcgaccacgcagaggtgctgggt
gaaaaaatacgtatcagtggcggtggtcgctgtaacttcactaatttacacagtagccca
tccaactttttatcgctcaatcagcattttgttaaaagtgcattggcgagatatccttca
tctgaattcattaagctcgtgacgtcttatcgcattggttaccacgaaaaacatcaagga
caattattttgcgatgactctgccaagcaaattattgacatgcttttttctgaatgtact
aagggtagggtgagcattcgtaatccagtgagtattcggtctatcgaacaggttaatgat
tcgtggattgtcaatacggatgccggagttgaaaagtccaaggcggttgtgatggctaca
ggcggtttgccagtgccggccattggcgcaacggcctattctttagatattgccaaacag
tttgggttaaatgttgttgagccaaggcccgttttagtgccgctctcatttactgcagat
aattttggtggcctcaatgaattagcgggtcttagcgtcccagtcagaattgcttctggc
tccaaaggacatcgctatggtgcctgcagatttaatgaggacctattactgactcataaa
gggctatctggtcccgcagtgcttcaggcaagtagttattgggaagagggtgagcctatc
catattgattggcttggggcaatagagcgtcccggcggctttaattgcgatgaacttttt
aataatgaagagaatcgcttaaagttgaccgaaacgattttggcctctgtactgccacag
cgtctagccaaagcatttgcagatcaaagaaacttaacaggtagaaaatgggctgaagtt
tctaaaaaagatcgtcaagccctcaaagagcttattacaaactggtctgtaaagcctgcg
ggcactctcggttggaagaaggccgaagttatgttgggtggggtggataccaaagagtta
gatgtgcaaaccatgatgtcgcgcaagcaccaaggacttttctttattggcgaatgcgtc
gatgtcactggtcacttaggtgggcataacttccagtgggcctgggccagtggatttgct
tgtgcgcacgccctataa

DBGET integrated database retrieval system