KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0593Help
Entry
Pnec_0593         CDS       T00683                                 

Definition
(GenBank) hypothetical protein
Organism
pne  Polynucleobacter necessarius subsp. necessarius
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(517637..517738)
Genome map
AA seq 33 aa AA seqDB search
MDRLFDTIGLEIILVLNIRSREKKKRQNESLVD
NT seq 102 nt NT seq  +upstreamnt  +downstreamnt
atggatcgcctttttgacactatcggcctcgaaattattcttgttttaaatattcgctct
cgtgaaaaaaagaaaaggcaaaatgagtctctggtggattag

DBGET integrated database retrieval system