KEGG   Polynucleobacter necessarius: Pnec_0607Help
Entry
Pnec_0607         CDS       T00683                                 

Definition
(GenBank) alkyl hydroperoxide reductase/Thiol specific antioxidant/Mal allergen
Organism
pne  Polynucleobacter necessarius
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AhpC-TSA Thioredoxin_8 Redoxin Thioredoxin GAD GSHPx
Motif
Other DBs
NCBI-ProteinID: ACB43857
UniProt: B1XU30
Position
complement(526614..527027)
Genome map
AA seq 137 aa AA seqDB search
MLFTDLGLSESTLRAIAEEGVAINFWASWREPCREEFEELTQLQANYGPKGLVVLAVNLD
EIKPRILQFLKGNGFSENSIEILLNRNSIVYKAWRVRGLPTTFLVSRAGKIEGVWMGTIE
NIDSNEVKGKIETLLRQ
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgttatttacagatctcggtttatcagagtccactcttcgcgctattgctgaagaaggt
gttgcaatcaacttttgggccagctggcgtgaaccttgtcgcgaagaatttgaagagcta
actcaactacaggcaaactacggacccaaagggcttgttgttttagcagtgaatcttgat
gaaataaaaccacgcattctgcaatttctgaaagggaatggcttttcagaaaacagcatt
gaaatattgctcaatcgcaatagtattgtctataaggcctggagggtccgaggcttgcca
accacttttcttgtcagcagagctggtaagattgaaggagtatggatgggtacgatagaa
aatattgacagcaatgaagtcaaagggaaaatagaaacccttctccgccagtaa

DBGET integrated database retrieval system