KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0610Help
Entry
Pnec_0610         CDS       T00683                                 

Definition
(GenBank) GCN5-related N-acetyltransferase
Organism
pne  Polynucleobacter necessarius subsp. necessarius
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(528206..528463)
Genome map
AA seq 85 aa AA seqDB search
MVNLGAYQIQIGRMAVLTQFRGLGIGRRILETLIRLASSREAKTIILHSQVNAIPFYEKL
GFTTQGPIYIEVDIPHRNMILILQK
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
ttggtaaatttaggtgcttatcaaatacaaattgggcgcatggctgtattaactcaattt
agaggtcttggtataggaaggcgaattctagaaacactgattagattagcgagctcgcga
gaggcaaagacaatcatcctgcactcccaagtaaatgccatccctttttatgaaaagctg
ggctttacaacacaaggaccaatctacatagaggttgatatcccccaccgtaatatgatt
ctaatattgcaaaaataa

DBGET integrated database retrieval system