KEGG   Polynucleobacter necessarius: Pnec_0610Help
Entry
Pnec_0610         CDS       T00683                                 

Definition
(GenBank) GCN5-related N-acetyltransferase
Organism
pne  Polynucleobacter necessarius
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_10 Acetyltransf_7 Acetyltransf_1 FR47 Acetyltransf_9 Flavi_DEAD
Motif
Other DBs
NCBI-ProteinID: ACB43860
UniProt: B1XU33
Position
complement(528206..528463)
Genome map
AA seq 85 aa AA seqDB search
MVNLGAYQIQIGRMAVLTQFRGLGIGRRILETLIRLASSREAKTIILHSQVNAIPFYEKL
GFTTQGPIYIEVDIPHRNMILILQK
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
ttggtaaatttaggtgcttatcaaatacaaattgggcgcatggctgtattaactcaattt
agaggtcttggtataggaaggcgaattctagaaacactgattagattagcgagctcgcga
gaggcaaagacaatcatcctgcactcccaagtaaatgccatccctttttatgaaaagctg
ggctttacaacacaaggaccaatctacatagaggttgatatcccccaccgtaatatgatt
ctaatattgcaaaaataa

DBGET integrated database retrieval system