KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0611Help
Entry
Pnec_0611         CDS       T00683                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pne  Polynucleobacter necessarius subsp. necessarius
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
528876..529373
Genome map
AA seq 165 aa AA seqDB search
MLPLAADVVVLSATVDSVDAKKRIVVLKDTNGNLAQMNVAKSVNDLDKVKKGDVFLVEHA
QAVAVGLTAAVKDQKPGVSGMRSVVIADKGPAKPFEETTDTVYATVKISTIDQKTRIVTF
TMPSGEKQKVKVDPSVLGLEKFKAGDDVMVEFVDDTAIGFVTPKK
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgttgcctttggcagctgacgttgtagttttgagtgcaaccgttgattcagtagatgca
aagaagcgtatcgttgtattgaaagatactaatggtaatttggcacagatgaatgttgct
aaatctgttaatgatttagataaagttaaaaaaggcgacgtgttcttagttgagcatgca
caagcggttgctgtaggtttgacagctgctgttaaagatcagaagccgggcgtttcaggt
atgcgctctgtagtaatcgctgacaaaggtcctgctaagccatttgaagaaactacagac
actgtatacgcgactgtaaagatttcaacaatcgatcaaaagacacgtatcgtgactttt
acaatgccaagtggcgagaagcaaaaagttaaagtggatccatcagttcttggtcttgag
aaattcaaggctggtgacgatgtcatggttgagttcgttgacgacacagcaattggcttt
gttacacctaagaagtaa

DBGET integrated database retrieval system